NPPC (natriuretic peptide C)

Gene

• Entrez ID: 4880
• Gene name: Natriuretic peptide C
• Gene symbol: NPPC
• Synonyms (NCBI Gene): CNP, CNP2
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cardiac natriuretic peptides CNP-53, CNP-29 and CNP-22, which belong to the natriuretic family of peptides. The encoded p

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016398	hsa-miR-193b-3p	Microarray	20304954
MIRT527128	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT527127	hsa-miR-5680	PAR-CLIP	22012620
MIRT527126	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT527125	hsa-miR-4495	PAR-CLIP	22012620
MIRT527124	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT527123	hsa-miR-3148	PAR-CLIP	22012620
MIRT527128	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT527127	hsa-miR-5680	PAR-CLIP	22012620
MIRT527126	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT527125	hsa-miR-4495	PAR-CLIP	22012620
MIRT527124	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT527123	hsa-miR-3148	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001549	Process	Cumulus cell differentiation	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003418	Process	Growth plate cartilage chondrocyte differentiation	IEA
GO:0003418	Process	Growth plate cartilage chondrocyte differentiation	ISS
GO:0003419	Process	Growth plate cartilage chondrocyte proliferation	IEA
GO:0003419	Process	Growth plate cartilage chondrocyte proliferation	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	1672777, 16870210, 26980729
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IDA	1660465
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	1660465
GO:0005615	Component	Extracellular space	IEA
GO:0006182	Process	CGMP biosynthetic process	IBA
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006182	Process	CGMP biosynthetic process	IEA
GO:0006457	Process	Protein folding	IDA	16870210
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010753	Process	Positive regulation of cGMP-mediated signaling	IEA
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030250	Function	Guanylate cyclase activator activity	IDA	1660465
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0032991	Component	Protein-containing complex	IDA	16870210
GO:0035483	Process	Gastric emptying	IEA
GO:0036293	Process	Response to decreased oxygen levels	IEA
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048599	Process	Oocyte development	IEA
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0051276	Process	Chromosome organization	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051427	Function	Hormone receptor binding	IBA
GO:0051427	Function	Hormone receptor binding	IPI	1660465
GO:0051447	Process	Negative regulation of meiotic cell cycle	IDA	20947764
GO:0051447	Process	Negative regulation of meiotic cell cycle	IEA
GO:0061939	Process	C-di-GMP signaling	IEA
GO:0071965	Process	Multicellular organismal locomotion	IEA
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0098868	Process	Bone growth	ISS
GO:1900194	Process	Negative regulation of oocyte maturation	IDA	20947764
GO:1900194	Process	Negative regulation of oocyte maturation	IEA
GO:1903537	Process	Meiotic cell cycle process involved in oocyte maturation	IEA
GO:1904588	Process	Cellular response to glycoprotein	IEA
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

Other IDs

• MIM: 600296
• HGNC: 7941
• e!Ensembl: ENSG00000163273

Protein

• UniProt ID: P23582
• Protein name: C-type natriuretic peptide [Cleaved into: CNP-22; CNP-29; CNP-53]
• Protein function: [CNP-22]: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation (By similarity). May also be vasoactive and natriuretic (PubMed:1672777). Acts by s
• PDB: 1JDP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00212	ANP	96 → 126	Atrial natriuretic peptide	Family

• Tissue specificity: TISSUE SPECIFICITY: [CNP-22]: In the kidney, predominantly expressed in the distal tubular cells (at protein level). {ECO:0000269|PubMed:9794555}.
• Sequence:

  MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG
  GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS
  MSGLGC

• Sequence length: 126

Pathways

KEGG:

cGMP-PKG signaling pathway
Hormone signaling
Vascular smooth muscle contraction
Fluid shear stress and atherosclerosis

Reactome:

Physiological factors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, DEVELOPMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARTILAGE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Achondroplasia	Achondroplasia	BEFREE	20567091, 23200862, 25196103, 25650377, 26684019, 28644737, 28808977, 31235532, 31269546, 31789832		★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	28661490, 34930956, 35710503	Associate	★☆☆☆☆ Found in Text Mining only
Acromesomelic dysplasia Hunter-Thompson type	Acromesomelic dysplasia	BEFREE	20567091		★☆☆☆☆ Found in Text Mining only
ACROMESOMELIC DYSPLASIA, MAROTEAUX TYPE	Acromesomelic dysplasia	BEFREE	16384845		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	15598085		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	17223013		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	28101584		★☆☆☆☆ Found in Text Mining only
Anterior subcapsular cataract	Subcapsular cataract	BEFREE	31617266		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27873367		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27873367		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	17709640		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	17709640		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	17709640, 30878394		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	LHGDN	17709640		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10826560, 11500181, 17709640, 30223437, 30781751		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33653372	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11939588		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10826560, 11500181, 17709640, 30223437, 30781751		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34308964	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28875838		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	29506482		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25539505	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	CTD_human_DG	17676597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	29337566		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34352718	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	28661490	Associate	★☆☆☆☆ Found in Text Mining only
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	BEFREE	30239744		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11464256, 16179391, 23262354, 30218492, 30586761		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37101178	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	CTD_human_DG	17676597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	BEFREE	31617266		★☆☆☆☆ Found in Text Mining only
Catatonia	Catatonia	BEFREE	29252213, 29252214		★☆☆☆☆ Found in Text Mining only
CATSHL syndrome	Catshl syndrome	Pubtator	30032985	Associate	★☆☆☆☆ Found in Text Mining only
Chondromalacia	Chondromalacia	CTD_human_DG	17676597		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29506482, 31431448		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18850266, 20433683, 22884919, 23262354, 23542429, 23911666, 30903134		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28062626		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	15598085		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28062626		★☆☆☆☆ Found in Text Mining only
Craniofacial Dysostosis	Craniofacial Dysostosis	BEFREE	30048539		★☆☆☆☆ Found in Text Mining only
Craniofacial dysostosis type 1	Craniofacial Dysostosis	BEFREE	30048539		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30048539		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	9143234		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31029038		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17289171, 30391424, 31583569		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17289171, 30391424, 31431448, 31583569		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17289171		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30355676		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	23805197, 25650377, 26578640, 28661490, 28899838, 29566041, 30235256, 30794654, 31120905, 31789832		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	29506482		★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	26888452		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30232670		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	31187260		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28852070		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30114411		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30114411		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31421135		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22589395, 28122246		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22589395, 28122246		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28402948		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	23805197, 28661490, 32282051	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31345395		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18850266, 20433683, 22884919, 23262354, 23911666, 30903134		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25117468, 37798313	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	24260477	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	29739821		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	12452325	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10826560, 12452325, 30781751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12452325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	21815902	Associate	★☆☆☆☆ Found in Text Mining only
Hypochondroplasia (disorder)	Hypochondroplasia	BEFREE	23200862		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30671449		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10867534		★☆☆☆☆ Found in Text Mining only
Isolated Systolic Hypertension	Isolated systolic hypertension	Pubtator	26224401	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27725175		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34308964	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30355676		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22832658		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25930075, 31029038		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31345395		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29337566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25808436		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28122246		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	22811580		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	23805197	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31029038		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	22473874		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18676363		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	9050359, 9143234		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23262354, 28855643, 30903134		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25808436, 27748759, 28024639, 28122246, 29337566, 29405618		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	12167597		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	12167597		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	27748759		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30114411		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21397061, 36613584	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28852070, 29391544, 30114411, 31794787		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	11939588		★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	BEFREE	16384845, 30235256		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28673612		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28739556		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	26962968		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30586761		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	30586761		★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	8965095		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29535265, 29739821		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	17289171		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25808436		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19161538		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	23032943		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30671449		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	21570342	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16389193, 16891421, 17010574, 17223013, 17306456, 17964117, 18289148, 18496213, 19348671, 29187753, 29252214		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	16389193, 19034380, 19165527		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	17223013, 18289148, 25539505	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	17964117, 18289148, 19348671, 23032943, 24788877		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30423400		★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	BEFREE	16384845, 30235256		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	26888452		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28852070		★☆☆☆☆ Found in Text Mining only
Supraventricular tachycardia	Supraventricular tachycardia	LHGDN	17487764		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	22832658		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36562811	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	29033511		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	25117468, 25371308	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	11939588		★☆☆☆☆ Found in Text Mining only