NPAS2 (neuronal PAS domain protein 2)

Gene

• Entrez ID: 4862
• Gene name: Neuronal PAS domain protein 2
• Gene symbol: NPAS2
• Synonyms (NCBI Gene): MOP4, PASD4, bHLHe9
• Chromosome: 2
• Chromosome location: 2q11.2
• Summary: The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a m

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018156	hsa-miR-335-5p	Microarray	18185580
MIRT050815	hsa-miR-17-5p	CLASH	23622248
MIRT042271	hsa-miR-484	CLASH	23622248
MIRT296914	hsa-miR-93-5p	Microarray, qRT-PCR	22815788
MIRT1190291	hsa-miR-103a	CLIP-seq
MIRT1190292	hsa-miR-107	CLIP-seq
MIRT1190293	hsa-miR-1179	CLIP-seq
MIRT1190294	hsa-miR-1229	CLIP-seq
MIRT1190295	hsa-miR-1273f	CLIP-seq
MIRT1190296	hsa-miR-1295	CLIP-seq
MIRT1190297	hsa-miR-1825	CLIP-seq
MIRT1190298	hsa-miR-190	CLIP-seq
MIRT1190299	hsa-miR-190b	CLIP-seq
MIRT1190300	hsa-miR-199a-5p	CLIP-seq
MIRT1190301	hsa-miR-199b-5p	CLIP-seq
MIRT1190302	hsa-miR-296-3p	CLIP-seq
MIRT1190303	hsa-miR-30a	CLIP-seq
MIRT1190304	hsa-miR-30b	CLIP-seq
MIRT1190305	hsa-miR-30c	CLIP-seq
MIRT1190306	hsa-miR-30d	CLIP-seq
MIRT1190307	hsa-miR-30e	CLIP-seq
MIRT1190308	hsa-miR-342-5p	CLIP-seq
MIRT1190309	hsa-miR-3668	CLIP-seq
MIRT1190310	hsa-miR-3674	CLIP-seq
MIRT1190311	hsa-miR-409-5p	CLIP-seq
MIRT1190312	hsa-miR-4264	CLIP-seq
MIRT1190313	hsa-miR-4310	CLIP-seq
MIRT1190314	hsa-miR-4433	CLIP-seq
MIRT1190315	hsa-miR-4528	CLIP-seq
MIRT1190316	hsa-miR-4651	CLIP-seq
MIRT1190317	hsa-miR-4664-5p	CLIP-seq
MIRT1190318	hsa-miR-4684-3p	CLIP-seq
MIRT1190319	hsa-miR-4699-5p	CLIP-seq
MIRT1190320	hsa-miR-4703-3p	CLIP-seq
MIRT1190321	hsa-miR-4717-5p	CLIP-seq
MIRT1190322	hsa-miR-4718	CLIP-seq
MIRT1190323	hsa-miR-4756-3p	CLIP-seq
MIRT1190324	hsa-miR-4766-5p	CLIP-seq
MIRT1190325	hsa-miR-4793-3p	CLIP-seq
MIRT1190326	hsa-miR-4797-3p	CLIP-seq
MIRT1190327	hsa-miR-508-5p	CLIP-seq
MIRT1190328	hsa-miR-520a-5p	CLIP-seq
MIRT1190329	hsa-miR-525-5p	CLIP-seq
MIRT1190330	hsa-miR-556-3p	CLIP-seq
MIRT1190331	hsa-miR-595	CLIP-seq
MIRT1190332	hsa-miR-608	CLIP-seq
MIRT1190333	hsa-miR-629	CLIP-seq
MIRT1190334	hsa-miR-630	CLIP-seq
MIRT1190335	hsa-miR-661	CLIP-seq
MIRT1190336	hsa-miR-665	CLIP-seq
MIRT1551809	hsa-miR-19a	CLIP-seq
MIRT1551810	hsa-miR-19b	CLIP-seq
MIRT2284062	hsa-miR-214	CLIP-seq
MIRT1190303	hsa-miR-30a	CLIP-seq
MIRT1190304	hsa-miR-30b	CLIP-seq
MIRT1190305	hsa-miR-30c	CLIP-seq
MIRT1190306	hsa-miR-30d	CLIP-seq
MIRT1190307	hsa-miR-30e	CLIP-seq
MIRT2284063	hsa-miR-3198	CLIP-seq
MIRT2284064	hsa-miR-3619-5p	CLIP-seq
MIRT2284065	hsa-miR-4291	CLIP-seq
MIRT2284066	hsa-miR-4309	CLIP-seq
MIRT2284067	hsa-miR-432	CLIP-seq
MIRT2284068	hsa-miR-4653-3p	CLIP-seq
MIRT2284069	hsa-miR-499a-5p	CLIP-seq
MIRT2284070	hsa-miR-761	CLIP-seq
MIRT2284071	hsa-miR-890	CLIP-seq
MIRT2284072	hsa-miR-922	CLIP-seq
MIRT2439048	hsa-miR-216a	CLIP-seq
MIRT2439049	hsa-miR-216b	CLIP-seq
MIRT2439050	hsa-miR-4753-3p	CLIP-seq
MIRT2439051	hsa-miR-4768-5p	CLIP-seq
MIRT2439048	hsa-miR-216a	CLIP-seq
MIRT2439049	hsa-miR-216b	CLIP-seq
MIRT2439050	hsa-miR-4753-3p	CLIP-seq
MIRT2439051	hsa-miR-4768-5p	CLIP-seq
MIRT2582179	hsa-miR-1182	CLIP-seq
MIRT2582180	hsa-miR-1207-5p	CLIP-seq
MIRT2582181	hsa-miR-1288	CLIP-seq
MIRT2582182	hsa-miR-2110	CLIP-seq
MIRT2582183	hsa-miR-3144-5p	CLIP-seq
MIRT2582184	hsa-miR-3150a-3p	CLIP-seq
MIRT2582185	hsa-miR-3189-3p	CLIP-seq
MIRT2582186	hsa-miR-3191	CLIP-seq
MIRT2582187	hsa-miR-3199	CLIP-seq
MIRT2582188	hsa-miR-4418	CLIP-seq
MIRT2582189	hsa-miR-4652-5p	CLIP-seq
MIRT2582190	hsa-miR-4736	CLIP-seq
MIRT2582191	hsa-miR-4763-3p	CLIP-seq
MIRT2582192	hsa-miR-509-3-5p	CLIP-seq
MIRT2582193	hsa-miR-509-5p	CLIP-seq
MIRT2582179	hsa-miR-1182	CLIP-seq
MIRT2582180	hsa-miR-1207-5p	CLIP-seq
MIRT2582181	hsa-miR-1288	CLIP-seq
MIRT2582182	hsa-miR-2110	CLIP-seq
MIRT2582183	hsa-miR-3144-5p	CLIP-seq
MIRT2582184	hsa-miR-3150a-3p	CLIP-seq
MIRT2582185	hsa-miR-3189-3p	CLIP-seq
MIRT2582186	hsa-miR-3191	CLIP-seq
MIRT2582187	hsa-miR-3199	CLIP-seq
MIRT2582188	hsa-miR-4418	CLIP-seq
MIRT2582189	hsa-miR-4652-5p	CLIP-seq
MIRT2582190	hsa-miR-4736	CLIP-seq
MIRT2582191	hsa-miR-4763-3p	CLIP-seq
MIRT2582192	hsa-miR-509-3-5p	CLIP-seq
MIRT2582193	hsa-miR-509-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KAT2B	Unknown	14645221

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IDA	11441146
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9012850
GO:0005515	Function	Protein binding	IPI	14645221, 20211142, 24722188, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	14645221
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	18819933
GO:0007417	Process	Central nervous system development	TAS	9012850
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	IBA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0045739	Process	Positive regulation of DNA repair	IMP	18819933
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11441146
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	18819933
GO:0046872	Function	Metal ion binding	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0051775	Process	Response to redox state	IDA	11441146
GO:0051775	Process	Response to redox state	IEA
GO:0051879	Function	Hsp90 protein binding	IDA	9079689
GO:1990513	Component	CLOCK-BMAL transcription complex	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000987	Process	Positive regulation of behavioral fear response	ISS

Other IDs

• MIM: 603347
• HGNC: 7895
• e!Ensembl: ENSG00000170485

Protein

• UniProt ID: Q99743
• Protein name: Neuronal PAS domain-containing protein 2 (Neuronal PAS2) (Basic-helix-loop-helix-PAS protein MOP4) (Class E basic helix-loop-helix protein 9) (bHLHe9) (Member of PAS protein 4) (PAS domain-containing protein 4)
• Protein function: Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in g
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	10 → 60	Helix-loop-helix DNA-binding domain	Domain
  PF00989	PAS	84 → 176	PAS fold	Domain
  PF14598	PAS_11	248 → 355		Domain

• Sequence:

  MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
  EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
  PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPK
  EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
  MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
  QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
  RQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH
  TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
  PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
  NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
  RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQC
  QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
  NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
  LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR

• Sequence length: 824

Pathways

KEGG:

Circadian rhythm

Reactome:

BMAL1:CLOCK,NPAS2 activates circadian gene expression
PPARA activates gene expression
Circadian Clock

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Non-obstructive azoospermia	Likely pathogenic	rs879253743	RCV000234891	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN THYROID GLAND NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONOBIOLOGY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CREUTZFELDT JACOB DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NPAS2-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR AZOOSPERMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	31014124		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29163035		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29163035		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23335987, 26710124	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	17264841		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17264841		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Azoospermia, Nonobstructive	Azoospermia	BEFREE	25956372		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16528748, 20072116, 21835597, 22538398, 24389266		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	19839995, 20072116, 25989161	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	20072116, 25989161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	19839995		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17453337, 18819933, 19649706, 21140207, 22473669, 23725643, 23822714, 24978311, 28177907, 29455641		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17453337, 18819933, 19649706, 22473669, 23822714, 25485508, 28333141, 29958276	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	29285299		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18819933, 19457610, 19649706	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24754267, 28333141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29455641		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25227809		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28412756	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37154720	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24978311		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18819933		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38092774	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26388558		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19693801, 22538398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20072116	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36748323	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29541184		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29541184		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	21912186	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31778954		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24135790		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24135790		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35832846	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36699999	Associate	★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	16636276		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20571087		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	23335987	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	30518396		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30518396	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30518396	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30536616		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24754267, 28333141, 31765736		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34925645	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37398880	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17096334, 18819933, 24978311		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17096334		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	17096334, 18819933, 24978311		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20072116		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17453337, 18819933, 19649706, 21140207, 22473669, 23725643, 23822714, 24978311, 28177907, 28333141, 29455641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29541184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31014126		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29455641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	29285299		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17984998, 19934327, 29318656, 30665264, 30996687		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19457610, 23725643, 28177907, 28333141, 28799406, 30536616, 30843665		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17453337		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28799406		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28799406	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19693801		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	30962277		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	20072116		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29285299		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18819933, 19649706, 24978311, 28177907, 28333141, 29958276		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28177907		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29353016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17984998, 19934327, 29318656, 30665264, 30996687		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19934327, 29318656, 35154101	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28699174	Stimulate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	19839995	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31014126		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	24824748		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26710124		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30518396		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30518396	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30518396	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	19839995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	19839995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	19839995, 24824748		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19839995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19839995	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	LHGDN	12655319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	17969870, 21835597, 22137330, 22538398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	22538398, 26134245		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	39375341	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37398880	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20072116		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33858483	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28817668		★☆☆☆☆ Found in Text Mining only