Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4857
Gene name	NOVA alternative splicing regulator 1
Gene symbol	NOVA1
Synonyms (NCBI Gene)	Nova-1
Chromosome	14
Chromosome location	14q12
Summary	This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003039	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003039	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003039	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003039	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT018192	hsa-miR-335-5p	Microarray	18185580
MIRT020856	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT731858	hsa-miR-339-5p	Luciferase reporter assayqRT-PCRWestern blot	26391641
MIRT731858	hsa-miR-339-5p	Luciferase reporter assayqRT-PCRWestern blot	26391641
MIRT731858	hsa-miR-339-5p	Luciferase reporter assayqRT-PCRWestern blot	26391641
MIRT1190215	hsa-miR-1292	CLIP-seq
MIRT1190216	hsa-miR-193a-5p	CLIP-seq
MIRT1190217	hsa-miR-3147	CLIP-seq
MIRT1190218	hsa-miR-3179	CLIP-seq
MIRT1190219	hsa-miR-3190	CLIP-seq
MIRT1190220	hsa-miR-3202	CLIP-seq
MIRT1190221	hsa-miR-3973	CLIP-seq
MIRT1190222	hsa-miR-3976	CLIP-seq
MIRT1190223	hsa-miR-4271	CLIP-seq
MIRT1190224	hsa-miR-4425	CLIP-seq
MIRT1190225	hsa-miR-4471	CLIP-seq
MIRT1190226	hsa-miR-4533	CLIP-seq
MIRT1190227	hsa-miR-4645-3p	CLIP-seq
MIRT1190228	hsa-miR-4725-3p	CLIP-seq
MIRT1190229	hsa-miR-4731-3p	CLIP-seq
MIRT1190230	hsa-miR-4747-5p	CLIP-seq
MIRT1190231	hsa-miR-4772-5p	CLIP-seq
MIRT1190232	hsa-miR-4789-5p	CLIP-seq
MIRT1190233	hsa-miR-4801	CLIP-seq
MIRT1190234	hsa-miR-548l	CLIP-seq
MIRT1190235	hsa-miR-635	CLIP-seq
MIRT1190236	hsa-miR-873	CLIP-seq
MIRT1190237	hsa-miR-1178	CLIP-seq
MIRT1190238	hsa-miR-1245b-3p	CLIP-seq
MIRT1190239	hsa-miR-30a	CLIP-seq
MIRT1190240	hsa-miR-30b	CLIP-seq
MIRT1190241	hsa-miR-30c	CLIP-seq
MIRT1190242	hsa-miR-30d	CLIP-seq
MIRT1190243	hsa-miR-30e	CLIP-seq
MIRT1190244	hsa-miR-3157-5p	CLIP-seq
MIRT1190218	hsa-miR-3179	CLIP-seq
MIRT1190219	hsa-miR-3190	CLIP-seq
MIRT1190220	hsa-miR-3202	CLIP-seq
MIRT1190245	hsa-miR-3607-3p	CLIP-seq
MIRT1190246	hsa-miR-3686	CLIP-seq
MIRT1190223	hsa-miR-4271	CLIP-seq
MIRT1190226	hsa-miR-4533	CLIP-seq
MIRT1190247	hsa-miR-4691-3p	CLIP-seq
MIRT1190228	hsa-miR-4725-3p	CLIP-seq
MIRT1190230	hsa-miR-4747-5p	CLIP-seq
MIRT1190248	hsa-miR-4760-3p	CLIP-seq
MIRT1190231	hsa-miR-4772-5p	CLIP-seq
MIRT1190236	hsa-miR-873	CLIP-seq
MIRT2055094	hsa-miR-582-5p	CLIP-seq
MIRT2284035	hsa-miR-1207-5p	CLIP-seq
MIRT2284036	hsa-miR-2681	CLIP-seq
MIRT2284037	hsa-miR-3662	CLIP-seq
MIRT2284038	hsa-miR-3941	CLIP-seq
MIRT1190221	hsa-miR-3973	CLIP-seq
MIRT2284039	hsa-miR-4300	CLIP-seq
MIRT2284040	hsa-miR-4432	CLIP-seq
MIRT2284041	hsa-miR-4490	CLIP-seq
MIRT2284042	hsa-miR-466	CLIP-seq
MIRT2284043	hsa-miR-4672	CLIP-seq
MIRT2284044	hsa-miR-4736	CLIP-seq
MIRT2284045	hsa-miR-4763-3p	CLIP-seq
MIRT1190232	hsa-miR-4789-5p	CLIP-seq
MIRT2284046	hsa-miR-4797-5p	CLIP-seq
MIRT2284047	hsa-miR-544	CLIP-seq
MIRT2284048	hsa-miR-548u	CLIP-seq
MIRT2284049	hsa-miR-548v	CLIP-seq
MIRT2284050	hsa-miR-920	CLIP-seq
MIRT2582149	hsa-miR-1244	CLIP-seq
MIRT2582150	hsa-miR-132	CLIP-seq
MIRT2582151	hsa-miR-199a-3p	CLIP-seq
MIRT2582152	hsa-miR-199b-3p	CLIP-seq
MIRT2582153	hsa-miR-200b	CLIP-seq
MIRT2582154	hsa-miR-200c	CLIP-seq
MIRT2582155	hsa-miR-204	CLIP-seq
MIRT2582156	hsa-miR-211	CLIP-seq
MIRT2582157	hsa-miR-212	CLIP-seq
MIRT2582158	hsa-miR-3121-3p	CLIP-seq
MIRT2582159	hsa-miR-3129-3p	CLIP-seq
MIRT2582160	hsa-miR-3129-5p	CLIP-seq
MIRT2582161	hsa-miR-3591-5p	CLIP-seq
MIRT2582162	hsa-miR-3938	CLIP-seq
MIRT2284038	hsa-miR-3941	CLIP-seq
MIRT2582163	hsa-miR-4255	CLIP-seq
MIRT2582164	hsa-miR-429	CLIP-seq
MIRT2582165	hsa-miR-4523	CLIP-seq
MIRT2284042	hsa-miR-466	CLIP-seq
MIRT2582166	hsa-miR-4668-3p	CLIP-seq
MIRT2284043	hsa-miR-4672	CLIP-seq
MIRT2582167	hsa-miR-4714-3p	CLIP-seq
MIRT2582168	hsa-miR-4724-5p	CLIP-seq
MIRT2582169	hsa-miR-4729	CLIP-seq
MIRT2582170	hsa-miR-4753-3p	CLIP-seq
MIRT2582171	hsa-miR-4755-5p	CLIP-seq
MIRT2582172	hsa-miR-4768-5p	CLIP-seq
MIRT2582173	hsa-miR-4775	CLIP-seq
MIRT2284046	hsa-miR-4797-5p	CLIP-seq
MIRT2582174	hsa-miR-496	CLIP-seq
MIRT2582175	hsa-miR-548c-3p	CLIP-seq
MIRT2284049	hsa-miR-548v	CLIP-seq
MIRT2582176	hsa-miR-579	CLIP-seq
MIRT2582177	hsa-miR-623	CLIP-seq
MIRT2582178	hsa-miR-888	CLIP-seq
MIRT2582158	hsa-miR-3121-3p	CLIP-seq
MIRT2284038	hsa-miR-3941	CLIP-seq
MIRT2284042	hsa-miR-466	CLIP-seq
MIRT2284043	hsa-miR-4672	CLIP-seq
MIRT2582169	hsa-miR-4729	CLIP-seq
MIRT2582170	hsa-miR-4753-3p	CLIP-seq
MIRT2582172	hsa-miR-4768-5p	CLIP-seq
MIRT2284046	hsa-miR-4797-5p	CLIP-seq
MIRT2284049	hsa-miR-548v	CLIP-seq
MIRT2582176	hsa-miR-579	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	ISS
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0000398	Process	MRNA splicing, via spliceosome	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	ISS
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	27733149, 30853821
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0006396	Process	RNA processing	TAS	8398153
GO:0006397	Process	MRNA processing	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	TAS	8398153
GO:0051252	Process	Regulation of RNA metabolic process	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	27635635
GO:1990825	Function	Sequence-specific mRNA binding	IDA	10811881
GO:1990825	Function	Sequence-specific mRNA binding	IEA
GO:1990825	Function	Sequence-specific mRNA binding	ISS

MIM	HGNC	e!Ensembl
602157	7886	ENSG00000139910

P51513

Protein name

RNA-binding protein Nova-1 (Neuro-oncological ventral antigen 1) (Onconeural ventral antigen 1) (Paraneoplastic Ri antigen) (Ventral neuron-specific protein 1)

Protein function

Functions to regulate alternative splicing in neurons by binding pre-mRNA in a sequence-specific manner to activate exon inclusion or exclusion. It binds specifically to the sequences 5'-YCAY-3' and regulates splicing in only a subset of regulat

PDB

1DT4 , 2ANN , 2ANR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00013	KH_1	52 → 118	KH domain	Domain
PF00013	KH_1	173 → 239	KH domain	Domain
PF00013	KH_1	423 → 490	KH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in cerebellum, brain stem, hippocampus, and frontal cortex. {ECO:0000269|PubMed:8398153}.

Sequence

MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYA
AGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKI
REMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPN
STAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQK
IQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAF
PAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAAN
LLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGS
KDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAA
TQAAQYLITQRITYEQGVRAANPQKVG

Sequence length

507

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	37887320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	25299073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	25299073, 26108672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	38416679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	10368286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30599248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31298381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31298381, 32101070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30696738, 36284263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	38049848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24608171, 34288818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24553397, 28276498, 33203797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30599248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	38041124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31599400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia Familial	Dysautonomia	Pubtator	27483351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	27483351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30304561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38167429, 38416679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30304561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10735272, 30304561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35832652, 38416679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30599248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24608171, 27733149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	37887320	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35852380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36284263	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31298381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26673617, 27318497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31524231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24608171, 27733149, 28394091, 30568224		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29498217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29498217	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Disorders	Motor Disorders	BEFREE	8558240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10735272, 27318497, 27733149, 29498217, 31375778, 31524231		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10368286, 8558240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	31382054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31382054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30082712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	26108672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29118907, 30657551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Opsoclonus-Myoclonus Ataxia	Opsoclonus-myoclonus syndrome	BEFREE	10368286, 24608171, 8558240, 9789075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33340248, 33760207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31382054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	31382054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31375778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31375778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26673617, 27318497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26673617, 35578189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31524231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31524231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32317088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NOVA1 (NOVA alternative splicing regulator 1)