NOS2 (nitric oxide synthase 2)

Gene

• Entrez ID: 4843
• Gene name: Nitric oxide synthase 2
• Gene symbol: NOS2
• Synonyms (NCBI Gene): HEP-NOS, INOS, NOS, NOS2A
• Chromosome: 17
• Chromosome location: 17q11.2
• Summary: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducibl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007347	hsa-miR-26a-5p	qRT-PCR, Western blot	23338972
MIRT007347	hsa-miR-26a-5p	Luciferase reporter assay	26854724
MIRT007347	hsa-miR-26a-5p	Luciferase reporter assay	26854724
MIRT732802	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33318876
MIRT737162	hsa-miR-939-5p	qRT-PCR	33368266
MIRT755532	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755532	hsa-miR-149-5p	qRT-PCR	36250208
MIRT1189580	hsa-miR-1291	CLIP-seq
MIRT1189581	hsa-miR-146b-3p	CLIP-seq
MIRT1189582	hsa-miR-4330	CLIP-seq
MIRT2283906	hsa-miR-2682	CLIP-seq
MIRT2283907	hsa-miR-323-5p	CLIP-seq
MIRT2283908	hsa-miR-3614-5p	CLIP-seq
MIRT2283909	hsa-miR-3616-5p	CLIP-seq
MIRT2283910	hsa-miR-3647-5p	CLIP-seq
MIRT2283911	hsa-miR-3714	CLIP-seq
MIRT2283912	hsa-miR-4457	CLIP-seq
MIRT2283913	hsa-miR-449c	CLIP-seq
MIRT2283914	hsa-miR-4635	CLIP-seq
MIRT2283915	hsa-miR-4731-3p	CLIP-seq
MIRT2283916	hsa-miR-4801	CLIP-seq
MIRT2283917	hsa-miR-573	CLIP-seq
MIRT2283918	hsa-miR-876-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
APC	Activation	11935128
FOS	Activation	12788789
FOS	Repression	9776360
FOSL2	Activation	12788789
IKBKB	Repression	17478759
JUN	Activation	12788789
JUN	Repression	9776360
JUN	Unknown	14962367
JUND	Activation	12788789
KLF6	Activation	12590140
KLF6	Unknown	23831683
MTA1	Activation	20022949
NFKB1	Activation	15350552;17081374;17720813;18057724
NFKB1	Unknown	11438703;15170030;16283237;16318585;19766095
NFKBIA	Repression	17478759
RELA	Activation	15350552;17081374;17720813;18057724
RELA	Unknown	15170030;16283237;16318585;19766095;9712833
STAT1	Activation	12586443
STAT1	Unknown	16318585
STAT2	Activation	12586443
XBP1	Unknown	20637858
YY1	Unknown	20430007

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001912	Process	Positive regulation of leukocyte mediated cytotoxicity	TAS	10450191
GO:0002227	Process	Innate immune response in mucosa	NAS	18390757
GO:0004517	Function	Nitric-oxide synthase activity	IBA
GO:0004517	Function	Nitric-oxide synthase activity	IDA	7504305, 7682706, 35772285
GO:0004517	Function	Nitric-oxide synthase activity	IEA
GO:0004517	Function	Nitric-oxide synthase activity	TAS
GO:0005515	Function	Protein binding	IPI	12855682, 21199876, 25417112
GO:0005516	Function	Calmodulin binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	9916929, 12085352
GO:0005737	Component	Cytoplasm	IEA
GO:0005777	Component	Peroxisome	IDA	12085352
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IMP	7504305
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006527	Process	L-arginine catabolic process	IBA
GO:0006527	Process	L-arginine catabolic process	IDA	7504305
GO:0006527	Process	L-arginine catabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	ISS
GO:0006809	Process	Nitric oxide biosynthetic process	IBA
GO:0006809	Process	Nitric oxide biosynthetic process	IDA	7504305, 7682706
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0007263	Process	Nitric oxide mediated signal transduction	IBA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009617	Process	Response to bacterium	NAS	12085352
GO:0009725	Process	Response to hormone	IBA
GO:0010181	Function	FMN binding	IBA
GO:0010181	Function	FMN binding	IEA
GO:0010181	Function	FMN binding	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	12085352
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0018119	Process	Peptidyl-cysteine S-nitrosylation	ISS
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	ISS
GO:0030863	Component	Cortical cytoskeleton	IEA
GO:0032310	Process	Prostaglandin secretion	IDA	19688109
GO:0032496	Process	Response to lipopolysaccharide	IBA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19688109
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19688109
GO:0034617	Function	Tetrahydrobiopterin binding	IEA
GO:0034617	Function	Tetrahydrobiopterin binding	ISS
GO:0034618	Function	Arginine binding	IEA
GO:0034618	Function	Arginine binding	ISS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IMP	7544003
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	IMP	9284131
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043457	Process	Regulation of cellular respiration	TAS	10450191
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0045776	Process	Negative regulation of blood pressure	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	ISS
GO:0050661	Function	NADP binding	IEA
GO:0050661	Function	NADP binding	TAS	7504305
GO:0050796	Process	Regulation of insulin secretion	IMP	8383325
GO:0050829	Process	Defense response to Gram-negative bacterium	NAS	18390757
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IDA	19688109

Other IDs

• MIM: 163730
• HGNC: 7873
• e!Ensembl: ENSG00000007171

Protein

• UniProt ID: P35228
• Protein name: Nitric oxide synthase, inducible (EC 1.14.13.39) (Hepatocyte NOS) (HEP-NOS) (Inducible NO synthase) (Inducible NOS) (iNOS) (NOS type II) (Peptidyl-cysteine S-nitrosylase NOS2)
• Protein function: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body (PubMed:7504305, PubMed:7531687, PubMed:7544004, PubMed:7682706). In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitr
• PDB: 1NSI, 2LL6, 2NSI, 3E7G, 3EJ8, 3HR4, 4CX7, 4NOS, 5TP6, 5XN3, 6JWM, 6JWN, 6KEY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02898	NO_synthase	135 → 497	Nitric oxide synthase, oxygenase domain	Domain
  PF00258	Flavodoxin_1	541 → 672	Flavodoxin	Domain
  PF00667	FAD_binding_1	725 → 947	FAD binding domain	Domain
  PF00175	NAD_binding_1	979 → 1093	Oxidoreductase NAD-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets. Expressed in chondrocytes (PubMed:7504305). {ECO:0000269|PubMed:7504305}.
• Sequence:

  MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
  VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
  TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
  LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
  RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
  RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
  GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
  AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
  LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
  ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
  NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
  ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
  SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
  PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
  LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
  PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
  VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
  EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
  VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
  VAVQPSSLEMSAL

• Sequence length: 1153

Pathways

KEGG:

Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
HIF-1 signaling pathway
Peroxisome
Apelin signaling pathway
Relaxin signaling pathway
Alzheimer disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Pertussis
Leishmaniasis
Chagas disease
Toxoplasmosis
Amoebiasis
Tuberculosis
Pathways in cancer
Small cell lung cancer

Reactome:

ROS and RNS production in phagocytes
Nitric oxide stimulates guanylate cyclase
Interleukin-4 and Interleukin-13 signaling
Peroxisomal protein import
Inhibition of nitric oxide production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ARCH SYNDROMES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONNEVIE-ULLRICH SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGIOCARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGITIS, SCLEROSING	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CURLING ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS, NECROTIZING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC INSUFFICIENCY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, resistance to	protective	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, severe, resistance to	protective	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NOS2-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
repeat number of microsatellite	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TURNER SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY TRACT INFECTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY TRACT INFECTIONS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations