NOS1 (nitric oxide synthase 1)

Gene

• Entrez ID: 4842
• Gene name: Nitric oxide synthase 1
• Gene symbol: NOS1
• Synonyms (NCBI Gene): IHPS1, N-NOS, NC-NOS, NOS, bNOS, nNOS
• Chromosome: 12
• Chromosome location: 12q24.22
• Summary: The protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736673	hsa-miR-146a-3p	Northern blotting, RNA-seq, qRT-PCR	32758035
MIRT1189360	hsa-miR-103a	CLIP-seq
MIRT1189361	hsa-miR-107	CLIP-seq
MIRT1189362	hsa-miR-1183	CLIP-seq
MIRT1189363	hsa-miR-1184	CLIP-seq
MIRT1189364	hsa-miR-1200	CLIP-seq
MIRT1189365	hsa-miR-122	CLIP-seq
MIRT1189366	hsa-miR-1285	CLIP-seq
MIRT1189367	hsa-miR-1292	CLIP-seq
MIRT1189368	hsa-miR-1307	CLIP-seq
MIRT1189369	hsa-miR-1324	CLIP-seq
MIRT1189370	hsa-miR-1343	CLIP-seq
MIRT1189371	hsa-miR-2114	CLIP-seq
MIRT1189372	hsa-miR-3117-5p	CLIP-seq
MIRT1189373	hsa-miR-3122	CLIP-seq
MIRT1189374	hsa-miR-3135b	CLIP-seq
MIRT1189375	hsa-miR-3155	CLIP-seq
MIRT1189376	hsa-miR-3155b	CLIP-seq
MIRT1189377	hsa-miR-3187-5p	CLIP-seq
MIRT1189378	hsa-miR-3192	CLIP-seq
MIRT1189379	hsa-miR-3199	CLIP-seq
MIRT1189380	hsa-miR-338-3p	CLIP-seq
MIRT1189381	hsa-miR-3652	CLIP-seq
MIRT1189382	hsa-miR-3664-3p	CLIP-seq
MIRT1189383	hsa-miR-3689a-3p	CLIP-seq
MIRT1189384	hsa-miR-3689c	CLIP-seq
MIRT1189385	hsa-miR-377	CLIP-seq
MIRT1189386	hsa-miR-3913-5p	CLIP-seq
MIRT1189387	hsa-miR-3945	CLIP-seq
MIRT1189388	hsa-miR-4253	CLIP-seq
MIRT1189389	hsa-miR-4284	CLIP-seq
MIRT1189390	hsa-miR-4314	CLIP-seq
MIRT1189391	hsa-miR-4329	CLIP-seq
MIRT1189392	hsa-miR-4418	CLIP-seq
MIRT1189393	hsa-miR-4430	CLIP-seq
MIRT1189394	hsa-miR-4433	CLIP-seq
MIRT1189395	hsa-miR-4459	CLIP-seq
MIRT1189396	hsa-miR-4466	CLIP-seq
MIRT1189397	hsa-miR-4471	CLIP-seq
MIRT1189398	hsa-miR-4530	CLIP-seq
MIRT1189399	hsa-miR-4638-5p	CLIP-seq
MIRT1189400	hsa-miR-4646-5p	CLIP-seq
MIRT1189401	hsa-miR-4652-5p	CLIP-seq
MIRT1189402	hsa-miR-4695-5p	CLIP-seq
MIRT1189403	hsa-miR-4728-5p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT1189405	hsa-miR-4740-5p	CLIP-seq
MIRT1189406	hsa-miR-4761-5p	CLIP-seq
MIRT1189407	hsa-miR-4768-3p	CLIP-seq
MIRT1189408	hsa-miR-4786-5p	CLIP-seq
MIRT1189409	hsa-miR-4799-5p	CLIP-seq
MIRT1189410	hsa-miR-484	CLIP-seq
MIRT1189411	hsa-miR-509-3-5p	CLIP-seq
MIRT1189412	hsa-miR-509-5p	CLIP-seq
MIRT1189413	hsa-miR-510	CLIP-seq
MIRT1189414	hsa-miR-512-5p	CLIP-seq
MIRT1189415	hsa-miR-545	CLIP-seq
MIRT1189416	hsa-miR-582-3p	CLIP-seq
MIRT1189417	hsa-miR-612	CLIP-seq
MIRT1189418	hsa-miR-668	CLIP-seq
MIRT1189419	hsa-miR-675	CLIP-seq
MIRT1189420	hsa-miR-769-5p	CLIP-seq
MIRT1189421	hsa-miR-935	CLIP-seq
MIRT1189367	hsa-miR-1292	CLIP-seq
MIRT1189422	hsa-miR-1321	CLIP-seq
MIRT1189423	hsa-miR-2355-5p	CLIP-seq
MIRT1189372	hsa-miR-3117-5p	CLIP-seq
MIRT1189424	hsa-miR-3162-5p	CLIP-seq
MIRT1189378	hsa-miR-3192	CLIP-seq
MIRT1189379	hsa-miR-3199	CLIP-seq
MIRT1189383	hsa-miR-3689a-3p	CLIP-seq
MIRT1189384	hsa-miR-3689c	CLIP-seq
MIRT1189425	hsa-miR-3940-3p	CLIP-seq
MIRT1189390	hsa-miR-4314	CLIP-seq
MIRT1189391	hsa-miR-4329	CLIP-seq
MIRT1189397	hsa-miR-4471	CLIP-seq
MIRT1189400	hsa-miR-4646-5p	CLIP-seq
MIRT1189401	hsa-miR-4652-5p	CLIP-seq
MIRT1189403	hsa-miR-4728-5p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT1189426	hsa-miR-4739	CLIP-seq
MIRT1189405	hsa-miR-4740-5p	CLIP-seq
MIRT1189427	hsa-miR-4756-5p	CLIP-seq
MIRT1189408	hsa-miR-4786-5p	CLIP-seq
MIRT1189420	hsa-miR-769-5p	CLIP-seq
MIRT1189428	hsa-miR-1268	CLIP-seq
MIRT1189429	hsa-miR-1268b	CLIP-seq
MIRT1189430	hsa-miR-1273g	CLIP-seq
MIRT1189367	hsa-miR-1292	CLIP-seq
MIRT1189431	hsa-miR-129-5p	CLIP-seq
MIRT1189432	hsa-miR-132	CLIP-seq
MIRT1189433	hsa-miR-1976	CLIP-seq
MIRT1189434	hsa-miR-212	CLIP-seq
MIRT1189435	hsa-miR-24	CLIP-seq
MIRT1189372	hsa-miR-3117-5p	CLIP-seq
MIRT1189436	hsa-miR-3176	CLIP-seq
MIRT1189378	hsa-miR-3192	CLIP-seq
MIRT1189380	hsa-miR-338-3p	CLIP-seq
MIRT1189437	hsa-miR-3686	CLIP-seq
MIRT1189383	hsa-miR-3689a-3p	CLIP-seq
MIRT1189384	hsa-miR-3689c	CLIP-seq
MIRT1189438	hsa-miR-3922-3p	CLIP-seq
MIRT1189389	hsa-miR-4284	CLIP-seq
MIRT1189390	hsa-miR-4314	CLIP-seq
MIRT1189439	hsa-miR-4438	CLIP-seq
MIRT1189397	hsa-miR-4471	CLIP-seq
MIRT1189440	hsa-miR-451b	CLIP-seq
MIRT1189398	hsa-miR-4530	CLIP-seq
MIRT1189400	hsa-miR-4646-5p	CLIP-seq
MIRT1189441	hsa-miR-4652-3p	CLIP-seq
MIRT1189442	hsa-miR-4696	CLIP-seq
MIRT1189443	hsa-miR-4715-3p	CLIP-seq
MIRT1189403	hsa-miR-4728-5p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT1189444	hsa-miR-4742-3p	CLIP-seq
MIRT1189445	hsa-miR-5095	CLIP-seq
MIRT1189446	hsa-miR-5096	CLIP-seq
MIRT1189447	hsa-miR-585	CLIP-seq
MIRT1189448	hsa-miR-661	CLIP-seq
MIRT1189367	hsa-miR-1292	CLIP-seq
MIRT1189372	hsa-miR-3117-5p	CLIP-seq
MIRT1551802	hsa-miR-3149	CLIP-seq
MIRT1189378	hsa-miR-3192	CLIP-seq
MIRT1189390	hsa-miR-4314	CLIP-seq
MIRT1189397	hsa-miR-4471	CLIP-seq
MIRT1189400	hsa-miR-4646-5p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT1189439	hsa-miR-4438	CLIP-seq
MIRT1189445	hsa-miR-5095	CLIP-seq
MIRT2283869	hsa-miR-1182	CLIP-seq
MIRT1189363	hsa-miR-1184	CLIP-seq
MIRT1189365	hsa-miR-122	CLIP-seq
MIRT2283870	hsa-miR-1245	CLIP-seq
MIRT2283871	hsa-miR-1254	CLIP-seq
MIRT1189428	hsa-miR-1268	CLIP-seq
MIRT1189429	hsa-miR-1268b	CLIP-seq
MIRT1189367	hsa-miR-1292	CLIP-seq
MIRT2283872	hsa-miR-1297	CLIP-seq
MIRT2283873	hsa-miR-1303	CLIP-seq
MIRT1189368	hsa-miR-1307	CLIP-seq
MIRT1189370	hsa-miR-1343	CLIP-seq
MIRT2283874	hsa-miR-140-3p	CLIP-seq
MIRT2283875	hsa-miR-150	CLIP-seq
MIRT2283876	hsa-miR-1827	CLIP-seq
MIRT2283877	hsa-miR-193a-5p	CLIP-seq
MIRT1189433	hsa-miR-1976	CLIP-seq
MIRT2283878	hsa-miR-204	CLIP-seq
MIRT2283879	hsa-miR-211	CLIP-seq
MIRT1189435	hsa-miR-24	CLIP-seq
MIRT2283880	hsa-miR-26a	CLIP-seq
MIRT2283881	hsa-miR-26b	CLIP-seq
MIRT2283882	hsa-miR-3116	CLIP-seq
MIRT1189372	hsa-miR-3117-5p	CLIP-seq
MIRT1189374	hsa-miR-3135b	CLIP-seq
MIRT2283883	hsa-miR-3136-3p	CLIP-seq
MIRT1189375	hsa-miR-3155	CLIP-seq
MIRT1189376	hsa-miR-3155b	CLIP-seq
MIRT2283884	hsa-miR-3159	CLIP-seq
MIRT1189378	hsa-miR-3192	CLIP-seq
MIRT2283885	hsa-miR-3194-3p	CLIP-seq
MIRT2283886	hsa-miR-3649	CLIP-seq
MIRT1189381	hsa-miR-3652	CLIP-seq
MIRT2283887	hsa-miR-3672	CLIP-seq
MIRT2283888	hsa-miR-371-5p	CLIP-seq
MIRT1189385	hsa-miR-377	CLIP-seq
MIRT2283889	hsa-miR-4258	CLIP-seq
MIRT2283890	hsa-miR-4279	CLIP-seq
MIRT1189389	hsa-miR-4284	CLIP-seq
MIRT2283891	hsa-miR-431	CLIP-seq
MIRT1189390	hsa-miR-4314	CLIP-seq
MIRT1189391	hsa-miR-4329	CLIP-seq
MIRT1189392	hsa-miR-4418	CLIP-seq
MIRT1189393	hsa-miR-4430	CLIP-seq
MIRT1189439	hsa-miR-4438	CLIP-seq
MIRT2283892	hsa-miR-4465	CLIP-seq
MIRT1189397	hsa-miR-4471	CLIP-seq
MIRT2283893	hsa-miR-4486	CLIP-seq
MIRT2283894	hsa-miR-4494	CLIP-seq
MIRT2283895	hsa-miR-4505	CLIP-seq
MIRT1189399	hsa-miR-4638-5p	CLIP-seq
MIRT1189400	hsa-miR-4646-5p	CLIP-seq
MIRT2283896	hsa-miR-4707-3p	CLIP-seq
MIRT1189443	hsa-miR-4715-3p	CLIP-seq
MIRT2283897	hsa-miR-4722-3p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT2283898	hsa-miR-4755-5p	CLIP-seq
MIRT2283899	hsa-miR-4775	CLIP-seq
MIRT1189410	hsa-miR-484	CLIP-seq
MIRT1189411	hsa-miR-509-3-5p	CLIP-seq
MIRT1189445	hsa-miR-5095	CLIP-seq
MIRT1189412	hsa-miR-509-5p	CLIP-seq
MIRT1189413	hsa-miR-510	CLIP-seq
MIRT2283900	hsa-miR-562	CLIP-seq
MIRT1189447	hsa-miR-585	CLIP-seq
MIRT2283901	hsa-miR-590-3p	CLIP-seq
MIRT2283902	hsa-miR-623	CLIP-seq
MIRT2283903	hsa-miR-647	CLIP-seq
MIRT1189448	hsa-miR-661	CLIP-seq
MIRT1189418	hsa-miR-668	CLIP-seq
MIRT1189363	hsa-miR-1184	CLIP-seq
MIRT1189365	hsa-miR-122	CLIP-seq
MIRT1189367	hsa-miR-1292	CLIP-seq
MIRT1189370	hsa-miR-1343	CLIP-seq
MIRT2391652	hsa-miR-2276	CLIP-seq
MIRT1189435	hsa-miR-24	CLIP-seq
MIRT1189372	hsa-miR-3117-5p	CLIP-seq
MIRT1189374	hsa-miR-3135b	CLIP-seq
MIRT1189378	hsa-miR-3192	CLIP-seq
MIRT2391653	hsa-miR-3614-5p	CLIP-seq
MIRT1189381	hsa-miR-3652	CLIP-seq
MIRT1189383	hsa-miR-3689a-3p	CLIP-seq
MIRT1189384	hsa-miR-3689c	CLIP-seq
MIRT2391654	hsa-miR-378g	CLIP-seq
MIRT1189389	hsa-miR-4284	CLIP-seq
MIRT1189390	hsa-miR-4314	CLIP-seq
MIRT1189392	hsa-miR-4418	CLIP-seq
MIRT1189393	hsa-miR-4430	CLIP-seq
MIRT2391655	hsa-miR-4437	CLIP-seq
MIRT1189397	hsa-miR-4471	CLIP-seq
MIRT1189400	hsa-miR-4646-5p	CLIP-seq
MIRT2391656	hsa-miR-4674	CLIP-seq
MIRT1189442	hsa-miR-4696	CLIP-seq
MIRT1189403	hsa-miR-4728-5p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT1189411	hsa-miR-509-3-5p	CLIP-seq
MIRT1189412	hsa-miR-509-5p	CLIP-seq
MIRT2391657	hsa-miR-596	CLIP-seq
MIRT2283871	hsa-miR-1254	CLIP-seq
MIRT1189422	hsa-miR-1321	CLIP-seq
MIRT2455312	hsa-miR-298	CLIP-seq
MIRT2283882	hsa-miR-3116	CLIP-seq
MIRT1189373	hsa-miR-3122	CLIP-seq
MIRT1551802	hsa-miR-3149	CLIP-seq
MIRT2455313	hsa-miR-3152-5p	CLIP-seq
MIRT1189424	hsa-miR-3162-5p	CLIP-seq
MIRT2455314	hsa-miR-3173-3p	CLIP-seq
MIRT1189380	hsa-miR-338-3p	CLIP-seq
MIRT1189381	hsa-miR-3652	CLIP-seq
MIRT1189383	hsa-miR-3689a-3p	CLIP-seq
MIRT1189384	hsa-miR-3689c	CLIP-seq
MIRT2455315	hsa-miR-3689d	CLIP-seq
MIRT1189385	hsa-miR-377	CLIP-seq
MIRT1189386	hsa-miR-3913-5p	CLIP-seq
MIRT2455316	hsa-miR-3929	CLIP-seq
MIRT2455317	hsa-miR-411	CLIP-seq
MIRT2455318	hsa-miR-4419b	CLIP-seq
MIRT2455319	hsa-miR-4423-5p	CLIP-seq
MIRT1189393	hsa-miR-4430	CLIP-seq
MIRT2455320	hsa-miR-4478	CLIP-seq
MIRT1189398	hsa-miR-4530	CLIP-seq
MIRT2455321	hsa-miR-4656	CLIP-seq
MIRT1189403	hsa-miR-4728-5p	CLIP-seq
MIRT1189426	hsa-miR-4739	CLIP-seq
MIRT1189427	hsa-miR-4756-5p	CLIP-seq
MIRT2455322	hsa-miR-485-5p	CLIP-seq
MIRT2455323	hsa-miR-550a	CLIP-seq
MIRT1189448	hsa-miR-661	CLIP-seq
MIRT1189365	hsa-miR-122	CLIP-seq
MIRT2283872	hsa-miR-1297	CLIP-seq
MIRT1189370	hsa-miR-1343	CLIP-seq
MIRT2283877	hsa-miR-193a-5p	CLIP-seq
MIRT1189435	hsa-miR-24	CLIP-seq
MIRT2283880	hsa-miR-26a	CLIP-seq
MIRT2283881	hsa-miR-26b	CLIP-seq
MIRT2582054	hsa-miR-296-5p	CLIP-seq
MIRT1189373	hsa-miR-3122	CLIP-seq
MIRT1189374	hsa-miR-3135b	CLIP-seq
MIRT1551802	hsa-miR-3149	CLIP-seq
MIRT2582055	hsa-miR-3170	CLIP-seq
MIRT1189380	hsa-miR-338-3p	CLIP-seq
MIRT2582056	hsa-miR-3613-3p	CLIP-seq
MIRT1189381	hsa-miR-3652	CLIP-seq
MIRT2582057	hsa-miR-3664-5p	CLIP-seq
MIRT2283887	hsa-miR-3672	CLIP-seq
MIRT1189383	hsa-miR-3689a-3p	CLIP-seq
MIRT1189384	hsa-miR-3689c	CLIP-seq
MIRT1189386	hsa-miR-3913-5p	CLIP-seq
MIRT2455316	hsa-miR-3929	CLIP-seq
MIRT2455317	hsa-miR-411	CLIP-seq
MIRT2582058	hsa-miR-4260	CLIP-seq
MIRT1189389	hsa-miR-4284	CLIP-seq
MIRT2455318	hsa-miR-4419b	CLIP-seq
MIRT1189393	hsa-miR-4430	CLIP-seq
MIRT2582059	hsa-miR-4432	CLIP-seq
MIRT1189439	hsa-miR-4438	CLIP-seq
MIRT2283892	hsa-miR-4465	CLIP-seq
MIRT2455320	hsa-miR-4478	CLIP-seq
MIRT1189440	hsa-miR-451b	CLIP-seq
MIRT2582060	hsa-miR-4522	CLIP-seq
MIRT1189398	hsa-miR-4530	CLIP-seq
MIRT2455321	hsa-miR-4656	CLIP-seq
MIRT1189442	hsa-miR-4696	CLIP-seq
MIRT1189443	hsa-miR-4715-3p	CLIP-seq
MIRT1189403	hsa-miR-4728-5p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT2283899	hsa-miR-4775	CLIP-seq
MIRT2455322	hsa-miR-485-5p	CLIP-seq
MIRT1189445	hsa-miR-5095	CLIP-seq
MIRT2283901	hsa-miR-590-3p	CLIP-seq
MIRT2582061	hsa-miR-615-5p	CLIP-seq
MIRT1189365	hsa-miR-122	CLIP-seq
MIRT2283872	hsa-miR-1297	CLIP-seq
MIRT2686438	hsa-miR-1323	CLIP-seq
MIRT1189370	hsa-miR-1343	CLIP-seq
MIRT2283877	hsa-miR-193a-5p	CLIP-seq
MIRT2283880	hsa-miR-26a	CLIP-seq
MIRT2283881	hsa-miR-26b	CLIP-seq
MIRT2582054	hsa-miR-296-5p	CLIP-seq
MIRT1189373	hsa-miR-3122	CLIP-seq
MIRT1189374	hsa-miR-3135b	CLIP-seq
MIRT1551802	hsa-miR-3149	CLIP-seq
MIRT2582055	hsa-miR-3170	CLIP-seq
MIRT1189380	hsa-miR-338-3p	CLIP-seq
MIRT2686439	hsa-miR-345	CLIP-seq
MIRT2582056	hsa-miR-3613-3p	CLIP-seq
MIRT1189381	hsa-miR-3652	CLIP-seq
MIRT2582057	hsa-miR-3664-5p	CLIP-seq
MIRT2283887	hsa-miR-3672	CLIP-seq
MIRT1189383	hsa-miR-3689a-3p	CLIP-seq
MIRT1189384	hsa-miR-3689c	CLIP-seq
MIRT1189386	hsa-miR-3913-5p	CLIP-seq
MIRT2455316	hsa-miR-3929	CLIP-seq
MIRT2582058	hsa-miR-4260	CLIP-seq
MIRT2455318	hsa-miR-4419b	CLIP-seq
MIRT1189393	hsa-miR-4430	CLIP-seq
MIRT2582059	hsa-miR-4432	CLIP-seq
MIRT1189439	hsa-miR-4438	CLIP-seq
MIRT2283892	hsa-miR-4465	CLIP-seq
MIRT2455320	hsa-miR-4478	CLIP-seq
MIRT1189440	hsa-miR-451b	CLIP-seq
MIRT2582060	hsa-miR-4522	CLIP-seq
MIRT1189398	hsa-miR-4530	CLIP-seq
MIRT2455321	hsa-miR-4656	CLIP-seq
MIRT1189442	hsa-miR-4696	CLIP-seq
MIRT1189443	hsa-miR-4715-3p	CLIP-seq
MIRT1189403	hsa-miR-4728-5p	CLIP-seq
MIRT2686440	hsa-miR-4732-3p	CLIP-seq
MIRT1189404	hsa-miR-4735-5p	CLIP-seq
MIRT2283899	hsa-miR-4775	CLIP-seq
MIRT2455322	hsa-miR-485-5p	CLIP-seq
MIRT1189445	hsa-miR-5095	CLIP-seq
MIRT2686441	hsa-miR-548c-3p	CLIP-seq
MIRT2686442	hsa-miR-548o	CLIP-seq
MIRT2283901	hsa-miR-590-3p	CLIP-seq
MIRT2582061	hsa-miR-615-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	17081374
NR0B1	Activation	19726747
RELA	Activation	17081374
SP1	Unknown	12237165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEP	16276418
GO:0001917	Component	Photoreceptor inner segment	ISS	17027776
GO:0002028	Process	Regulation of sodium ion transport	IEA
GO:0002028	Process	Regulation of sodium ion transport	ISS
GO:0004517	Function	Nitric-oxide synthase activity	IBA
GO:0004517	Function	Nitric-oxide synthase activity	IDA	1689048, 35772285
GO:0004517	Function	Nitric-oxide synthase activity	IEA
GO:0004517	Function	Nitric-oxide synthase activity	ISS	7545544, 23549614
GO:0004517	Function	Nitric-oxide synthase activity	TAS
GO:0005246	Function	Calcium channel regulator activity	TAS	18337493
GO:0005515	Function	Protein binding	IPI	11149895, 17161399, 27225184
GO:0005516	Function	Calmodulin binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	23549614
GO:0005737	Component	Cytoplasm	TAS	17892502
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS	7545544
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005901	Component	Caveola	IEA
GO:0006527	Process	L-arginine catabolic process	IBA
GO:0006527	Process	L-arginine catabolic process	TAS	7545544
GO:0006809	Process	Nitric oxide biosynthetic process	IBA
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006809	Process	Nitric oxide biosynthetic process	ISS	7545544
GO:0006813	Process	Potassium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006941	Process	Striated muscle contraction	IEA
GO:0006941	Process	Striated muscle contraction	ISS
GO:0007154	Process	Cell communication	IEA
GO:0007263	Process	Nitric oxide mediated signal transduction	IBA
GO:0007520	Process	Myoblast fusion	TAS	7545544
GO:0008015	Process	Blood circulation	IEA
GO:0009408	Process	Response to heat	IDA	18048451
GO:0009725	Process	Response to hormone	IBA
GO:0010181	Function	FMN binding	IBA
GO:0010181	Function	FMN binding	IEA
GO:0010181	Function	FMN binding	ISS
GO:0010523	Process	Negative regulation of calcium ion transport into cytosol	TAS	17568574
GO:0010882	Process	Regulation of cardiac muscle contraction by calcium ion signaling	TAS	18337493
GO:0010959	Process	Regulation of metal ion transport	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0014069	Component	Postsynaptic density	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016529	Component	Sarcoplasmic reticulum	IDA	9892689
GO:0017080	Function	Sodium channel regulator activity	ISS
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	ISS
GO:0023052	Process	Signaling	IEA
GO:0030018	Component	Z disc	IEA
GO:0030315	Component	T-tubule	IEA
GO:0032496	Process	Response to lipopolysaccharide	IBA
GO:0032991	Component	Protein-containing complex	ISS
GO:0033017	Component	Sarcoplasmic reticulum membrane	IEA
GO:0033555	Process	Multicellular organismal response to stress	IMP	18391107
GO:0034617	Function	Tetrahydrobiopterin binding	NAS	7488039
GO:0034618	Function	Arginine binding	IEA
GO:0034618	Function	Arginine binding	TAS	17029414
GO:0035605	Function	Peptidyl-cysteine S-nitrosylase activity	IMP	28089352
GO:0042178	Process	Xenobiotic catabolic process	IEA
GO:0042178	Process	Xenobiotic catabolic process	ISS
GO:0042311	Process	Vasodilation	IDA	18048451
GO:0042311	Process	Vasodilation	IMP	18391107
GO:0042383	Component	Sarcolemma	IDA	7545544, 27225184
GO:0042383	Component	Sarcolemma	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043267	Process	Negative regulation of potassium ion transport	IEA
GO:0043267	Process	Negative regulation of potassium ion transport	ISS
GO:0043271	Process	Negative regulation of monoatomic ion transport	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IMP	28089352
GO:0044305	Component	Calyx of Held	IEA
GO:0044325	Function	Transmembrane transporter binding	ISS
GO:0044325	Function	Transmembrane transporter binding	TAS	21536106
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0045776	Process	Negative regulation of blood pressure	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046870	Function	Cadmium ion binding	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	ISS	23549614
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	17027776
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	ISS
GO:0050661	Function	NADP binding	IEA
GO:0050661	Function	NADP binding	ISS
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0051612	Process	Negative regulation of serotonin uptake	IEA
GO:0051612	Process	Negative regulation of serotonin uptake	ISS
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051926	Process	Negative regulation of calcium ion transport	IEA
GO:0051926	Process	Negative regulation of calcium ion transport	ISS
GO:0055117	Process	Regulation of cardiac muscle contraction	TAS	9892689
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0065008	Process	Regulation of biological quality	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	ISS
GO:0071944	Component	Cell periphery	ISS	23549614
GO:0097110	Function	Scaffold protein binding	ISS
GO:0098735	Process	Positive regulation of the force of heart contraction	IEA
GO:0098735	Process	Positive regulation of the force of heart contraction	ISS
GO:0099163	Process	Synaptic signaling by nitric oxide	IEA
GO:0106071	Process	Positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0106071	Process	Positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:1902307	Process	Positive regulation of sodium ion transmembrane transport	ISS
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	TAS	18337493, 21536106
GO:1903522	Process	Regulation of blood circulation	IEA
GO:1905026	Process	Positive regulation of membrane repolarization during ventricular cardiac muscle cell action potential	TAS	18337493

Other IDs

• MIM: 163731
• HGNC: 7872
• e!Ensembl: ENSG00000089250

Protein

• UniProt ID: P29475
• Protein name: Nitric oxide synthase 1 (EC 1.14.13.39) (Constitutive NOS) (NC-NOS) (NOS type I) (Neuronal NOS) (N-NOS) (nNOS) (Nitric oxide synthase, brain) (bNOS) (Peptidyl-cysteine S-nitrosylase NOS1)
• Protein function: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cy
• PDB: 4D1N, 4UCH, 4UH5, 4UH6, 4V3U, 5ADF, 5ADG, 5ADI, 5FVU, 5FVV, 5FVW, 5FVX, 5UO1, 5UO2, 5UO3, 5UO4, 5UO5, 5UO6, 5UO7, 5VUV, 5VUW, 5VUX, 5VUY, 5VUZ, 5VV0, 5VV1, 5VV2, 5VV3, 5VV4, 5VV5, 6AUY, 6AUZ, 6AV0, 6AV1, 6AV2, 6AV3, 6AV4, 6AV5, 6CIC, 6CID, 6NG1, 6NG2, 6NG4, 6NG5, 6NG6, 6NG7, 6NG8, 6NGA, 6NGB, 6NGC, 6NGD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	17 → 96	PDZ domain	Domain
  PF02898	NO_synthase	355 → 717	Nitric oxide synthase, oxygenase domain	Domain
  PF00258	Flavodoxin_1	762 → 935	Flavodoxin	Domain
  PF00667	FAD_binding_1	990 → 1219	FAD binding domain	Domain
  PF00175	NAD_binding_1	1251 → 1365	Oxidoreductase NAD-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is ubiquitously expressed: detected in skeletal muscle and brain, also in testis, lung and kidney, and at low levels in heart, adrenal gland and retina. Not detected in the platelets. Isoform 3 is expressed only in testis. Is
• Sequence:

  MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
  GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
  RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
  RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV
  DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS
  KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF
  PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC
  VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW
  NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
  IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
  RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
  ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
  WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE
  IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ
  EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
  GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
  SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
  RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV
  ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY
  EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
  SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
  FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE
  PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE
  DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS

• Sequence length: 1434

Pathways

KEGG:

Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
Hormone signaling
Phagosome
Apelin signaling pathway
Circadian entrainment
Long-term depression
Relaxin signaling pathway
Salivary secretion
Alzheimer disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
Viral myocarditis

Reactome:

ROS and RNS production in phagocytes
Nitric oxide stimulates guanylate cyclase
Ion homeostasis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBELLAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC ENCEPHALOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL PERFORATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NOS1-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis, infantile hypertrophic, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINATION DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations