Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4841
Gene name	Non-POU domain containing octamer binding
Gene symbol	NONO
Synonyms (NCBI Gene)	MRXS34NMT55NRB54P54P54NRBPPP1R114
Chromosome	X
Chromosome location	Xq13.1
Summary	This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carc

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs869025343	G>A	Pathogenic	Synonymous variant, coding sequence variant
rs869025345	C>T	Pathogenic	Stop gained, coding sequence variant
rs876661316	G>T	Pathogenic	Splice donor variant
rs1057518476	TT>-	Pathogenic	Frameshift variant, coding sequence variant, 5 prime UTR variant
rs1057524408	C>T	Pathogenic	Coding sequence variant, stop gained, intron variant
rs1085307870	C>T	Pathogenic	Coding sequence variant, stop gained
rs1114167441	G>T	Pathogenic	Missense variant, coding sequence variant
rs1555949215	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1602385860	C>-	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs1602386427	C>-	Pathogenic	Coding sequence variant, frameshift variant, 5 prime UTR variant
rs1602387702	C>T	Pathogenic	Coding sequence variant, stop gained

476

Show/Hide all (476)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022721	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT050934	hsa-miR-17-5p	CLASH	23622248
MIRT048776	hsa-miR-93-5p	CLASH	23622248
MIRT048042	hsa-miR-148a-3p	CLASH	23622248
MIRT045567	hsa-miR-149-5p	CLASH	23622248
MIRT043592	hsa-miR-148b-3p	CLASH	23622248
MIRT041772	hsa-miR-484	CLASH	23622248
MIRT041216	hsa-miR-193b-3p	CLASH	23622248
MIRT041216	hsa-miR-193b-3p	CLASH	23622248
MIRT040602	hsa-miR-92b-3p	CLASH	23622248
MIRT040343	hsa-miR-615-3p	CLASH	23622248
MIRT038697	hsa-miR-30c-2-3p	CLASH	23622248
MIRT038503	hsa-miR-296-3p	CLASH	23622248
MIRT037971	hsa-miR-505-5p	CLASH	23622248
MIRT037550	hsa-miR-744-5p	CLASH	23622248
MIRT035994	hsa-miR-1301-3p	CLASH	23622248
MIRT531513	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT531512	hsa-miR-6755-5p	PAR-CLIP	22012620
MIRT531511	hsa-miR-7113-5p	PAR-CLIP	22012620
MIRT531509	hsa-miR-4685-5p	PAR-CLIP	22012620
MIRT531510	hsa-miR-6837-5p	PAR-CLIP	22012620
MIRT531508	hsa-miR-1237-3p	PAR-CLIP	22012620
MIRT531507	hsa-miR-1248	PAR-CLIP	22012620
MIRT531506	hsa-miR-554	PAR-CLIP	22012620
MIRT531504	hsa-miR-4794	PAR-CLIP	22012620
MIRT531505	hsa-miR-664a-5p	PAR-CLIP	22012620
MIRT045567	hsa-miR-149-5p	PAR-CLIP	22012620
MIRT531503	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT531501	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT531502	hsa-miR-8086	PAR-CLIP	22012620
MIRT531500	hsa-miR-6069	PAR-CLIP	22012620
MIRT531499	hsa-miR-197-5p	PAR-CLIP	22012620
MIRT531498	hsa-miR-3132	PAR-CLIP	22012620
MIRT531497	hsa-miR-4650-3p	PAR-CLIP	22012620
MIRT531496	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT531495	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT366904	hsa-miR-3936	PAR-CLIP	23446348
MIRT366901	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT518631	hsa-miR-1197	PAR-CLIP	23446348
MIRT518630	hsa-miR-8076	PAR-CLIP	23446348
MIRT366903	hsa-miR-3675-5p	PAR-CLIP	23446348
MIRT366907	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT366908	hsa-miR-8060	PAR-CLIP	23446348
MIRT518629	hsa-miR-7515	PAR-CLIP	23446348
MIRT366902	hsa-miR-3179	PAR-CLIP	23446348
MIRT366906	hsa-miR-6881-5p	PAR-CLIP	23446348
MIRT518628	hsa-miR-3117-3p	PAR-CLIP	23446348
MIRT366905	hsa-miR-6864-5p	PAR-CLIP	23446348
MIRT531499	hsa-miR-197-5p	PAR-CLIP	26701625
MIRT531498	hsa-miR-3132	PAR-CLIP	26701625
MIRT531512	hsa-miR-6755-5p	PAR-CLIP	26701625
MIRT531513	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT531512	hsa-miR-6755-5p	PAR-CLIP	22012620
MIRT531511	hsa-miR-7113-5p	PAR-CLIP	22012620
MIRT531509	hsa-miR-4685-5p	PAR-CLIP	22012620
MIRT531510	hsa-miR-6837-5p	PAR-CLIP	22012620
MIRT531508	hsa-miR-1237-3p	PAR-CLIP	22012620
MIRT531507	hsa-miR-1248	PAR-CLIP	22012620
MIRT531506	hsa-miR-554	PAR-CLIP	22012620
MIRT531504	hsa-miR-4794	PAR-CLIP	22012620
MIRT531505	hsa-miR-664a-5p	PAR-CLIP	22012620
MIRT045567	hsa-miR-149-5p	PAR-CLIP	22012620
MIRT531503	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT531501	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT531502	hsa-miR-8086	PAR-CLIP	22012620
MIRT531500	hsa-miR-6069	PAR-CLIP	22012620
MIRT531499	hsa-miR-197-5p	PAR-CLIP	22012620
MIRT531498	hsa-miR-3132	PAR-CLIP	22012620
MIRT531497	hsa-miR-4650-3p	PAR-CLIP	22012620
MIRT531496	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT531495	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT366904	hsa-miR-3936	PAR-CLIP	23446348
MIRT366901	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT518631	hsa-miR-1197	PAR-CLIP	23446348
MIRT518630	hsa-miR-8076	PAR-CLIP	23446348
MIRT366903	hsa-miR-3675-5p	PAR-CLIP	23446348
MIRT366907	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT366908	hsa-miR-8060	PAR-CLIP	23446348
MIRT518629	hsa-miR-7515	PAR-CLIP	23446348
MIRT366902	hsa-miR-3179	PAR-CLIP	23446348
MIRT366906	hsa-miR-6881-5p	PAR-CLIP	23446348
MIRT518628	hsa-miR-3117-3p	PAR-CLIP	23446348
MIRT366905	hsa-miR-6864-5p	PAR-CLIP	23446348
MIRT1189214	hsa-miR-132	CLIP-seq
MIRT1189215	hsa-miR-212	CLIP-seq
MIRT1189216	hsa-miR-2355-5p	CLIP-seq
MIRT1189217	hsa-miR-3679-3p	CLIP-seq
MIRT1189218	hsa-miR-3690	CLIP-seq
MIRT1189219	hsa-miR-421	CLIP-seq
MIRT1189220	hsa-miR-4638-3p	CLIP-seq
MIRT1189221	hsa-miR-4709-5p	CLIP-seq
MIRT1189222	hsa-miR-4778-3p	CLIP-seq
MIRT1189223	hsa-miR-490-3p	CLIP-seq
MIRT1189224	hsa-miR-619	CLIP-seq
MIRT1189225	hsa-miR-651	CLIP-seq
MIRT1189226	hsa-miR-1237	CLIP-seq
MIRT1189227	hsa-miR-141	CLIP-seq
MIRT1189228	hsa-miR-149	CLIP-seq
MIRT1189229	hsa-miR-200a	CLIP-seq
MIRT1189230	hsa-miR-3122	CLIP-seq
MIRT1189231	hsa-miR-338-3p	CLIP-seq
MIRT1189232	hsa-miR-3689a-3p	CLIP-seq
MIRT1189233	hsa-miR-3689c	CLIP-seq
MIRT1189234	hsa-miR-3913-5p	CLIP-seq
MIRT1189235	hsa-miR-4310	CLIP-seq
MIRT1189236	hsa-miR-4728-5p	CLIP-seq
MIRT1189237	hsa-miR-101	CLIP-seq
MIRT1189238	hsa-miR-1343	CLIP-seq
MIRT1189239	hsa-miR-144	CLIP-seq
MIRT1189240	hsa-miR-3909	CLIP-seq
MIRT1189241	hsa-miR-4455	CLIP-seq
MIRT1189242	hsa-miR-4662a-3p	CLIP-seq
MIRT1189243	hsa-miR-609	CLIP-seq
MIRT1189237	hsa-miR-101	CLIP-seq
MIRT1189244	hsa-miR-10a	CLIP-seq
MIRT1189245	hsa-miR-10b	CLIP-seq
MIRT1189246	hsa-miR-1229	CLIP-seq
MIRT1189247	hsa-miR-1257	CLIP-seq
MIRT1189248	hsa-miR-1275	CLIP-seq
MIRT1189249	hsa-miR-1303	CLIP-seq
MIRT1189214	hsa-miR-132	CLIP-seq
MIRT1189238	hsa-miR-1343	CLIP-seq
MIRT1189250	hsa-miR-140-3p	CLIP-seq
MIRT1189239	hsa-miR-144	CLIP-seq
MIRT1189251	hsa-miR-2113	CLIP-seq
MIRT1189215	hsa-miR-212	CLIP-seq
MIRT1189252	hsa-miR-23a	CLIP-seq
MIRT1189253	hsa-miR-23b	CLIP-seq
MIRT1189254	hsa-miR-23c	CLIP-seq
MIRT1189255	hsa-miR-24	CLIP-seq
MIRT1189256	hsa-miR-297	CLIP-seq
MIRT1189257	hsa-miR-299-3p	CLIP-seq
MIRT1189258	hsa-miR-3120-3p	CLIP-seq
MIRT1189259	hsa-miR-3192	CLIP-seq
MIRT1189231	hsa-miR-338-3p	CLIP-seq
MIRT1189260	hsa-miR-338-5p	CLIP-seq
MIRT1189261	hsa-miR-3622a-3p	CLIP-seq
MIRT1189262	hsa-miR-3622b-3p	CLIP-seq
MIRT1189263	hsa-miR-3688-5p	CLIP-seq
MIRT1189218	hsa-miR-3690	CLIP-seq
MIRT1189264	hsa-miR-374c	CLIP-seq
MIRT1189265	hsa-miR-376a	CLIP-seq
MIRT1189266	hsa-miR-376b	CLIP-seq
MIRT1189267	hsa-miR-3908	CLIP-seq
MIRT1189268	hsa-miR-3974	CLIP-seq
MIRT1189219	hsa-miR-421	CLIP-seq
MIRT1189269	hsa-miR-4283	CLIP-seq
MIRT1189270	hsa-miR-4284	CLIP-seq
MIRT1189271	hsa-miR-4287	CLIP-seq
MIRT1189235	hsa-miR-4310	CLIP-seq
MIRT1189272	hsa-miR-4433	CLIP-seq
MIRT1189273	hsa-miR-4452	CLIP-seq
MIRT1189241	hsa-miR-4455	CLIP-seq
MIRT1189274	hsa-miR-4459	CLIP-seq
MIRT1189275	hsa-miR-4489	CLIP-seq
MIRT1189276	hsa-miR-4491	CLIP-seq
MIRT1189277	hsa-miR-4525	CLIP-seq
MIRT1189220	hsa-miR-4638-3p	CLIP-seq
MIRT1189278	hsa-miR-4657	CLIP-seq
MIRT1189279	hsa-miR-4665-5p	CLIP-seq
MIRT1189280	hsa-miR-4685-3p	CLIP-seq
MIRT1189281	hsa-miR-4704-3p	CLIP-seq
MIRT1189221	hsa-miR-4709-5p	CLIP-seq
MIRT1189282	hsa-miR-4714-3p	CLIP-seq
MIRT1189283	hsa-miR-4723-5p	CLIP-seq
MIRT1189284	hsa-miR-4768-3p	CLIP-seq
MIRT1189285	hsa-miR-4780	CLIP-seq
MIRT1189286	hsa-miR-4790-3p	CLIP-seq
MIRT1189223	hsa-miR-490-3p	CLIP-seq
MIRT1189287	hsa-miR-501-3p	CLIP-seq
MIRT1189288	hsa-miR-502-3p	CLIP-seq
MIRT1189289	hsa-miR-567	CLIP-seq
MIRT1189243	hsa-miR-609	CLIP-seq
MIRT1189290	hsa-miR-616	CLIP-seq
MIRT1189224	hsa-miR-619	CLIP-seq
MIRT1189291	hsa-miR-623	CLIP-seq
MIRT1189292	hsa-miR-625	CLIP-seq
MIRT1189293	hsa-miR-655	CLIP-seq
MIRT1189294	hsa-miR-659	CLIP-seq
MIRT1189295	hsa-miR-767-5p	CLIP-seq
MIRT1189296	hsa-miR-873	CLIP-seq
MIRT1189260	hsa-miR-338-5p	CLIP-seq
MIRT1556738	hsa-miR-3920	CLIP-seq
MIRT1189287	hsa-miR-501-3p	CLIP-seq
MIRT1189288	hsa-miR-502-3p	CLIP-seq
MIRT1189295	hsa-miR-767-5p	CLIP-seq
MIRT1189237	hsa-miR-101	CLIP-seq
MIRT1189244	hsa-miR-10a	CLIP-seq
MIRT1189245	hsa-miR-10b	CLIP-seq
MIRT1189246	hsa-miR-1229	CLIP-seq
MIRT1189247	hsa-miR-1257	CLIP-seq
MIRT2054778	hsa-miR-1273	CLIP-seq
MIRT1189248	hsa-miR-1275	CLIP-seq
MIRT2054779	hsa-miR-1282	CLIP-seq
MIRT1189249	hsa-miR-1303	CLIP-seq
MIRT1189214	hsa-miR-132	CLIP-seq
MIRT1189250	hsa-miR-140-3p	CLIP-seq
MIRT1189227	hsa-miR-141	CLIP-seq
MIRT1189239	hsa-miR-144	CLIP-seq
MIRT1189228	hsa-miR-149	CLIP-seq
MIRT2054780	hsa-miR-1908	CLIP-seq
MIRT1189229	hsa-miR-200a	CLIP-seq
MIRT1189251	hsa-miR-2113	CLIP-seq
MIRT1189215	hsa-miR-212	CLIP-seq
MIRT2054781	hsa-miR-216b	CLIP-seq
MIRT1189252	hsa-miR-23a	CLIP-seq
MIRT1189253	hsa-miR-23b	CLIP-seq
MIRT1189254	hsa-miR-23c	CLIP-seq
MIRT1189256	hsa-miR-297	CLIP-seq
MIRT1189257	hsa-miR-299-3p	CLIP-seq
MIRT2054782	hsa-miR-3138	CLIP-seq
MIRT2054783	hsa-miR-3140-5p	CLIP-seq
MIRT2054784	hsa-miR-3152-5p	CLIP-seq
MIRT2054785	hsa-miR-3157-3p	CLIP-seq
MIRT2054786	hsa-miR-3180	CLIP-seq
MIRT2054787	hsa-miR-3180-3p	CLIP-seq
MIRT1189259	hsa-miR-3192	CLIP-seq
MIRT2054788	hsa-miR-3196	CLIP-seq
MIRT1189231	hsa-miR-338-3p	CLIP-seq
MIRT1189260	hsa-miR-338-5p	CLIP-seq
MIRT2054789	hsa-miR-34a	CLIP-seq
MIRT2054790	hsa-miR-34c-5p	CLIP-seq
MIRT1189261	hsa-miR-3622a-3p	CLIP-seq
MIRT1189262	hsa-miR-3622b-3p	CLIP-seq
MIRT2054791	hsa-miR-3646	CLIP-seq
MIRT2054792	hsa-miR-3647-3p	CLIP-seq
MIRT2054793	hsa-miR-3662	CLIP-seq
MIRT2054794	hsa-miR-3675-3p	CLIP-seq
MIRT1189263	hsa-miR-3688-5p	CLIP-seq
MIRT1189264	hsa-miR-374c	CLIP-seq
MIRT1189267	hsa-miR-3908	CLIP-seq
MIRT1556738	hsa-miR-3920	CLIP-seq
MIRT1189268	hsa-miR-3974	CLIP-seq
MIRT1189219	hsa-miR-421	CLIP-seq
MIRT1189269	hsa-miR-4283	CLIP-seq
MIRT1189271	hsa-miR-4287	CLIP-seq
MIRT2054795	hsa-miR-4290	CLIP-seq
MIRT2054796	hsa-miR-4426	CLIP-seq
MIRT2054797	hsa-miR-4432	CLIP-seq
MIRT2054798	hsa-miR-4443	CLIP-seq
MIRT1189273	hsa-miR-4452	CLIP-seq
MIRT2054799	hsa-miR-4486	CLIP-seq
MIRT2054800	hsa-miR-4488	CLIP-seq
MIRT1189275	hsa-miR-4489	CLIP-seq
MIRT1189276	hsa-miR-4491	CLIP-seq
MIRT2054801	hsa-miR-449a	CLIP-seq
MIRT2054802	hsa-miR-449b	CLIP-seq
MIRT1189277	hsa-miR-4525	CLIP-seq
MIRT2054803	hsa-miR-4530	CLIP-seq
MIRT2054804	hsa-miR-4534	CLIP-seq
MIRT2054805	hsa-miR-4647	CLIP-seq
MIRT2054806	hsa-miR-4649-5p	CLIP-seq
MIRT1189278	hsa-miR-4657	CLIP-seq
MIRT2054807	hsa-miR-4662b	CLIP-seq
MIRT1189279	hsa-miR-4665-5p	CLIP-seq
MIRT2054808	hsa-miR-4680-3p	CLIP-seq
MIRT1189280	hsa-miR-4685-3p	CLIP-seq
MIRT2054809	hsa-miR-4697-5p	CLIP-seq
MIRT1189281	hsa-miR-4704-3p	CLIP-seq
MIRT2054810	hsa-miR-4704-5p	CLIP-seq
MIRT1189221	hsa-miR-4709-5p	CLIP-seq
MIRT1189283	hsa-miR-4723-5p	CLIP-seq
MIRT2054811	hsa-miR-4731-3p	CLIP-seq
MIRT2054812	hsa-miR-4752	CLIP-seq
MIRT2054813	hsa-miR-4774-3p	CLIP-seq
MIRT1189285	hsa-miR-4780	CLIP-seq
MIRT2054814	hsa-miR-4787-5p	CLIP-seq
MIRT1189286	hsa-miR-4790-3p	CLIP-seq
MIRT2054815	hsa-miR-4797-5p	CLIP-seq
MIRT2054816	hsa-miR-4800-5p	CLIP-seq
MIRT2054817	hsa-miR-4801	CLIP-seq
MIRT2054818	hsa-miR-4802-5p	CLIP-seq
MIRT2054819	hsa-miR-499-5p	CLIP-seq
MIRT1189287	hsa-miR-501-3p	CLIP-seq
MIRT1189288	hsa-miR-502-3p	CLIP-seq
MIRT2054820	hsa-miR-508-5p	CLIP-seq
MIRT1189289	hsa-miR-567	CLIP-seq
MIRT1189290	hsa-miR-616	CLIP-seq
MIRT1189224	hsa-miR-619	CLIP-seq
MIRT1189291	hsa-miR-623	CLIP-seq
MIRT1189292	hsa-miR-625	CLIP-seq
MIRT1189225	hsa-miR-651	CLIP-seq
MIRT1189293	hsa-miR-655	CLIP-seq
MIRT2054821	hsa-miR-661	CLIP-seq
MIRT2054822	hsa-miR-663	CLIP-seq
MIRT2054823	hsa-miR-744	CLIP-seq
MIRT2054824	hsa-miR-766	CLIP-seq
MIRT1189295	hsa-miR-767-5p	CLIP-seq
MIRT1189296	hsa-miR-873	CLIP-seq
MIRT2054825	hsa-miR-874	CLIP-seq
MIRT1189248	hsa-miR-1275	CLIP-seq
MIRT1189275	hsa-miR-4489	CLIP-seq
MIRT1189277	hsa-miR-4525	CLIP-seq
MIRT1189279	hsa-miR-4665-5p	CLIP-seq
MIRT2054824	hsa-miR-766	CLIP-seq
MIRT1189237	hsa-miR-101	CLIP-seq
MIRT2054778	hsa-miR-1273	CLIP-seq
MIRT1189248	hsa-miR-1275	CLIP-seq
MIRT1189256	hsa-miR-297	CLIP-seq
MIRT1189257	hsa-miR-299-3p	CLIP-seq
MIRT1189231	hsa-miR-338-3p	CLIP-seq
MIRT1189269	hsa-miR-4283	CLIP-seq
MIRT1189235	hsa-miR-4310	CLIP-seq
MIRT2054799	hsa-miR-4486	CLIP-seq
MIRT1189275	hsa-miR-4489	CLIP-seq
MIRT1189276	hsa-miR-4491	CLIP-seq
MIRT1189277	hsa-miR-4525	CLIP-seq
MIRT2054806	hsa-miR-4649-5p	CLIP-seq
MIRT1189278	hsa-miR-4657	CLIP-seq
MIRT1189242	hsa-miR-4662a-3p	CLIP-seq
MIRT1189279	hsa-miR-4665-5p	CLIP-seq
MIRT1189283	hsa-miR-4723-5p	CLIP-seq
MIRT2054820	hsa-miR-508-5p	CLIP-seq
MIRT1189289	hsa-miR-567	CLIP-seq
MIRT1189292	hsa-miR-625	CLIP-seq
MIRT2054821	hsa-miR-661	CLIP-seq
MIRT2054824	hsa-miR-766	CLIP-seq
MIRT1189237	hsa-miR-101	CLIP-seq
MIRT1189244	hsa-miR-10a	CLIP-seq
MIRT1189245	hsa-miR-10b	CLIP-seq
MIRT1189226	hsa-miR-1237	CLIP-seq
MIRT2582013	hsa-miR-1245b-5p	CLIP-seq
MIRT2054778	hsa-miR-1273	CLIP-seq
MIRT1189249	hsa-miR-1303	CLIP-seq
MIRT1189227	hsa-miR-141	CLIP-seq
MIRT1189239	hsa-miR-144	CLIP-seq
MIRT1189228	hsa-miR-149	CLIP-seq
MIRT1189229	hsa-miR-200a	CLIP-seq
MIRT2582014	hsa-miR-2052	CLIP-seq
MIRT2054781	hsa-miR-216b	CLIP-seq
MIRT1189252	hsa-miR-23a	CLIP-seq
MIRT1189253	hsa-miR-23b	CLIP-seq
MIRT1189254	hsa-miR-23c	CLIP-seq
MIRT1189255	hsa-miR-24	CLIP-seq
MIRT1189258	hsa-miR-3120-3p	CLIP-seq
MIRT1189230	hsa-miR-3122	CLIP-seq
MIRT2582015	hsa-miR-3142	CLIP-seq
MIRT2054785	hsa-miR-3157-3p	CLIP-seq
MIRT2582016	hsa-miR-320a	CLIP-seq
MIRT2582017	hsa-miR-320b	CLIP-seq
MIRT2582018	hsa-miR-320c	CLIP-seq
MIRT2582019	hsa-miR-320d	CLIP-seq
MIRT1189231	hsa-miR-338-3p	CLIP-seq
MIRT2054791	hsa-miR-3646	CLIP-seq
MIRT2054792	hsa-miR-3647-3p	CLIP-seq
MIRT2054793	hsa-miR-3662	CLIP-seq
MIRT2054794	hsa-miR-3675-3p	CLIP-seq
MIRT1189232	hsa-miR-3689a-3p	CLIP-seq
MIRT1189233	hsa-miR-3689c	CLIP-seq
MIRT1189218	hsa-miR-3690	CLIP-seq
MIRT1189265	hsa-miR-376a	CLIP-seq
MIRT1189266	hsa-miR-376b	CLIP-seq
MIRT1189234	hsa-miR-3913-5p	CLIP-seq
MIRT1189270	hsa-miR-4284	CLIP-seq
MIRT1189271	hsa-miR-4287	CLIP-seq
MIRT2054795	hsa-miR-4290	CLIP-seq
MIRT2582020	hsa-miR-4305	CLIP-seq
MIRT1189235	hsa-miR-4310	CLIP-seq
MIRT2054796	hsa-miR-4426	CLIP-seq
MIRT2582021	hsa-miR-4429	CLIP-seq
MIRT2054797	hsa-miR-4432	CLIP-seq
MIRT1189272	hsa-miR-4433	CLIP-seq
MIRT2054798	hsa-miR-4443	CLIP-seq
MIRT1189274	hsa-miR-4459	CLIP-seq
MIRT2582022	hsa-miR-4477b	CLIP-seq
MIRT2054799	hsa-miR-4486	CLIP-seq
MIRT2054803	hsa-miR-4530	CLIP-seq
MIRT2054804	hsa-miR-4534	CLIP-seq
MIRT1189220	hsa-miR-4638-3p	CLIP-seq
MIRT2054805	hsa-miR-4647	CLIP-seq
MIRT2054806	hsa-miR-4649-5p	CLIP-seq
MIRT1189242	hsa-miR-4662a-3p	CLIP-seq
MIRT2054807	hsa-miR-4662b	CLIP-seq
MIRT1189280	hsa-miR-4685-3p	CLIP-seq
MIRT2054810	hsa-miR-4704-5p	CLIP-seq
MIRT1189282	hsa-miR-4714-3p	CLIP-seq
MIRT1189236	hsa-miR-4728-5p	CLIP-seq
MIRT2054811	hsa-miR-4731-3p	CLIP-seq
MIRT1189284	hsa-miR-4768-3p	CLIP-seq
MIRT1189222	hsa-miR-4778-3p	CLIP-seq
MIRT1189285	hsa-miR-4780	CLIP-seq
MIRT2054815	hsa-miR-4797-5p	CLIP-seq
MIRT2054817	hsa-miR-4801	CLIP-seq
MIRT2054818	hsa-miR-4802-5p	CLIP-seq
MIRT1189223	hsa-miR-490-3p	CLIP-seq
MIRT2054819	hsa-miR-499-5p	CLIP-seq
MIRT1189287	hsa-miR-501-3p	CLIP-seq
MIRT1189288	hsa-miR-502-3p	CLIP-seq
MIRT2582023	hsa-miR-508-3p	CLIP-seq
MIRT2054820	hsa-miR-508-5p	CLIP-seq
MIRT2582024	hsa-miR-539	CLIP-seq
MIRT2582025	hsa-miR-580	CLIP-seq
MIRT1189224	hsa-miR-619	CLIP-seq
MIRT1189291	hsa-miR-623	CLIP-seq
MIRT1189225	hsa-miR-651	CLIP-seq
MIRT2054821	hsa-miR-661	CLIP-seq
MIRT2054824	hsa-miR-766	CLIP-seq
MIRT1189295	hsa-miR-767-5p	CLIP-seq
MIRT1189296	hsa-miR-873	CLIP-seq
MIRT2054825	hsa-miR-874	CLIP-seq
MIRT1189237	hsa-miR-101	CLIP-seq
MIRT1189244	hsa-miR-10a	CLIP-seq
MIRT1189245	hsa-miR-10b	CLIP-seq
MIRT1189226	hsa-miR-1237	CLIP-seq
MIRT2582013	hsa-miR-1245b-5p	CLIP-seq
MIRT1189249	hsa-miR-1303	CLIP-seq
MIRT1189250	hsa-miR-140-3p	CLIP-seq
MIRT1189227	hsa-miR-141	CLIP-seq
MIRT1189239	hsa-miR-144	CLIP-seq
MIRT1189228	hsa-miR-149	CLIP-seq
MIRT1189229	hsa-miR-200a	CLIP-seq
MIRT2582014	hsa-miR-2052	CLIP-seq
MIRT2054781	hsa-miR-216b	CLIP-seq
MIRT1189252	hsa-miR-23a	CLIP-seq
MIRT1189253	hsa-miR-23b	CLIP-seq
MIRT1189254	hsa-miR-23c	CLIP-seq
MIRT1189258	hsa-miR-3120-3p	CLIP-seq
MIRT1189230	hsa-miR-3122	CLIP-seq
MIRT2582015	hsa-miR-3142	CLIP-seq
MIRT2054785	hsa-miR-3157-3p	CLIP-seq
MIRT2582016	hsa-miR-320a	CLIP-seq
MIRT2582017	hsa-miR-320b	CLIP-seq
MIRT2582018	hsa-miR-320c	CLIP-seq
MIRT2582019	hsa-miR-320d	CLIP-seq
MIRT1189231	hsa-miR-338-3p	CLIP-seq
MIRT1189260	hsa-miR-338-5p	CLIP-seq
MIRT2054791	hsa-miR-3646	CLIP-seq
MIRT2054792	hsa-miR-3647-3p	CLIP-seq
MIRT2054793	hsa-miR-3662	CLIP-seq
MIRT2054794	hsa-miR-3675-3p	CLIP-seq
MIRT1189232	hsa-miR-3689a-3p	CLIP-seq
MIRT1189233	hsa-miR-3689c	CLIP-seq
MIRT1189218	hsa-miR-3690	CLIP-seq
MIRT1189264	hsa-miR-374c	CLIP-seq
MIRT1189234	hsa-miR-3913-5p	CLIP-seq
MIRT1556738	hsa-miR-3920	CLIP-seq
MIRT1189271	hsa-miR-4287	CLIP-seq
MIRT2054795	hsa-miR-4290	CLIP-seq
MIRT2582020	hsa-miR-4305	CLIP-seq
MIRT1189235	hsa-miR-4310	CLIP-seq
MIRT2054796	hsa-miR-4426	CLIP-seq
MIRT2582021	hsa-miR-4429	CLIP-seq
MIRT1189272	hsa-miR-4433	CLIP-seq
MIRT2054798	hsa-miR-4443	CLIP-seq
MIRT1189274	hsa-miR-4459	CLIP-seq
MIRT2582022	hsa-miR-4477b	CLIP-seq
MIRT2054803	hsa-miR-4530	CLIP-seq
MIRT2054804	hsa-miR-4534	CLIP-seq
MIRT1189220	hsa-miR-4638-3p	CLIP-seq
MIRT2054805	hsa-miR-4647	CLIP-seq
MIRT1189242	hsa-miR-4662a-3p	CLIP-seq
MIRT2054807	hsa-miR-4662b	CLIP-seq
MIRT1189280	hsa-miR-4685-3p	CLIP-seq
MIRT2054810	hsa-miR-4704-5p	CLIP-seq
MIRT1189282	hsa-miR-4714-3p	CLIP-seq
MIRT1189236	hsa-miR-4728-5p	CLIP-seq
MIRT2054811	hsa-miR-4731-3p	CLIP-seq
MIRT1189284	hsa-miR-4768-3p	CLIP-seq
MIRT1189222	hsa-miR-4778-3p	CLIP-seq
MIRT1189285	hsa-miR-4780	CLIP-seq
MIRT2054817	hsa-miR-4801	CLIP-seq
MIRT2054818	hsa-miR-4802-5p	CLIP-seq
MIRT1189223	hsa-miR-490-3p	CLIP-seq
MIRT1189287	hsa-miR-501-3p	CLIP-seq
MIRT1189288	hsa-miR-502-3p	CLIP-seq
MIRT2582023	hsa-miR-508-3p	CLIP-seq
MIRT2582024	hsa-miR-539	CLIP-seq
MIRT2582025	hsa-miR-580	CLIP-seq
MIRT1189224	hsa-miR-619	CLIP-seq
MIRT1189291	hsa-miR-623	CLIP-seq
MIRT1189225	hsa-miR-651	CLIP-seq
MIRT1189293	hsa-miR-655	CLIP-seq
MIRT2054824	hsa-miR-766	CLIP-seq
MIRT1189295	hsa-miR-767-5p	CLIP-seq
MIRT1189296	hsa-miR-873	CLIP-seq
MIRT2054825	hsa-miR-874	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0002218	Process	Activation of innate immune response	IDA	28712728
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15790595, 16148043, 16169070, 16189514, 16417406, 16767080, 18077367, 18457437, 19874820, 21653829, 21988832, 22416126, 25416956, 25765647, 25959826, 26030138, 28514442, 30021884, 32296183, 33961781, 35271311, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15790595
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	9360842
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006310	Process	DNA recombination	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	TAS	9360842
GO:0006974	Process	DNA damage response	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	TAS	8371983
GO:0016020	Component	Membrane	HDA	19946888
GO:0016363	Component	Nuclear matrix	IDA	19874820
GO:0016607	Component	Nuclear speck	IEA
GO:0042382	Component	Paraspeckles	IDA	19716791
GO:0042382	Component	Paraspeckles	IDA	19217333
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042802	Function	Identical protein binding	IPI	16148043, 16189514, 21988832, 22416126, 23555304, 39251607
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:0106222	Function	LncRNA binding	IEA
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	15790595
GO:1904385	Process	Cellular response to angiotensin	IEA

MIM	HGNC	e!Ensembl
300084	7871	ENSG00000147140

Q15233

Protein name

Non-POU domain-containing octamer-binding protein (NonO protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit)

Protein function

DNA- and RNA binding protein, involved in several nuclear processes (PubMed:11525732, PubMed:12403470, PubMed:26571461). Binds the conventional octamer sequence in double-stranded DNA (PubMed:11525732, PubMed:12403470, PubMed:26571461). Also bin

PDB

3SDE , 5IFM , 6WMZ , 7LRQ , 7LRU , 7PU5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	76 → 140	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	150 → 217	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF08075	NOPS	221 → 272	NOPS (NUC059) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines. {ECO:0000269|PubMed:9341872}.

Sequence

MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK
NFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRT
LAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVI
VDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKL
VIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM
EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQE
EMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Sequence length

471

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Heart, malformation of	Likely pathogenic	rs2031334549	RCV001257383	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma	Pathogenic	rs1555950011	RCV000505623	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Pathogenic	rs2148038538	RCV002274394	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-ossifying fibromas with pathologic factures and X-linked intellectual disability	Pathogenic	rs2519886586	RCV003126382	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Syndromic X-linked intellectual disability 34	Likely pathogenic; Pathogenic	rs2148033540, rs2148033533, rs2148040741, rs2148033495, rs2148033408, rs2519885230, rs2519886525, rs869025343, rs869025344, rs869025345, rs876661316, rs2519886488, rs2519886575, rs2519896045, rs1114167441 View all (6 more)	RCV001582398 RCV002052249 RCV002226950 RCV002274463 RCV002274464 View all (16 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED, SYNDROMIC 34	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mild global developmental delay	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONO-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTINGTON SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WILMS TUMOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
X-LINKED SYNDROMIC INTELLECTUAL DISABILITY	—	ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (131)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Accessory nipple	Accessory Nipple	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	27108701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27108701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22118625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of Corpus Callosum	Corpus callosum agenesis	Pubtator	39709004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29426953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31512366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia of Phonation	Apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arnold-Chiari Malformation, Type I	Arnold-Chiari malformation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	36653413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral Wilms Tumor	Wilms tumor	CTD_human_DG	28825729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	9360842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26148231, 31733123, 9360842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11710964, 32576581, 32632453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	29713041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29620226, 35013116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33667716, 34079086, 34299096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33741027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	39709004	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36653413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35444189	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22118625, 27259250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22118625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	31634484		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27934879, 31277953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36653413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	39709004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysgenesis of corpus callosum	Dysplastic corpus callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia 3, Torsion, X-Linked	Dystonia	BEFREE	9341872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ebstein Anomaly	Ebstein anomaly of the tricuspid valve	BEFREE	30773818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ebstein Anomaly	Ebstein anomaly of the tricuspid valve	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28334947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29620226	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	29426953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31810606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	38341127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38303029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gross motor development delay	Developmental delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	38110236, 39709004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	36653413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Atrial	Congenital heart septal defect	Pubtator	39709004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	39709004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	39709004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	39542781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	BEFREE	30773818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34079086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile constant exotropia	Exotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26571461, 27329731, 30773818		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Intellectual developmental disorder	Pubtator	27329731, 39709004	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	38110236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular noncompaction	Left ventricular noncompaction	BEFREE	30773818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular noncompaction	Left ventricular noncompaction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular noncompaction cardiomyopathy	Cardiomyopathy	BEFREE	30773818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36875548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35803902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30377567, 31815296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32950106	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly-intellectual disability-left ventricular non compaction syndrome	Macrocephaly-Intellectual Disability-Left Ventricular Non Compaction Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26148231, 31733123, 9360842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31815296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29773901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29150959, 30767760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11710964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26148231, 9360842		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21642354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27816966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35444189	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation Autosomal Recessive 7	Intellectual developmental disorder	Pubtator	38110236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SYNDROMIC 34	Syndromic Mental Retardation, X-Linked	ORPHANET_DG	26571461		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SYNDROMIC 34	Syndromic Mental Retardation, X-Linked	GENOMICS_ENGLAND_DG	27550220		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SYNDROMIC 34	Syndromic Mental Retardation, X-Linked	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SYNDROMIC 34	Syndromic Mental Retardation, X-Linked	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	26254420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26254420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	ORPHANET_DG	20073616, 9393982		★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	27934879		★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29150959, 9360842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	CTD_human_DG	28825729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36416237, 39731187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-compaction cardiomyopathy	Noncompaction cardiomyopathy	BEFREE	27329731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	9393982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Perivascular Epithelioid Cell Neoplasms	Perivascular Epithelioid Neoplasms	BEFREE	26975036, 28009605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	29426953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Plagiocephaly	Plagiocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudobulbar Palsy	Pseudobulbar Palsy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34588774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Relative macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27934879, 28411178, 31277953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retrognathia	Retrognathia	Pubtator	38110236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29441870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26254420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29620226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29773901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia Ventricular	Ventricular tachycardia	Pubtator	36653413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29713041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30725116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30725116, 32128390, 32632453, 32724453, 35013116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18219107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32950106	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35444189	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	28825729, 40340749	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NONO (non-POU domain containing octamer binding)