NME2 (NME/NM23 nucleoside diphosphate kinase 2)

Gene

• Entrez ID: 4831
• Gene name: NME/NM23 nucleoside diphosphate kinase 2
• Gene symbol: NME2
• Synonyms (NCBI Gene): NDKB, NDPK-B, NDPKB, NM23-H2, NM23B, PUF
• Chromosome: 17
• Chromosome location: 17q21.33
• Summary: Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of `A` (encoded by NME1) and `B` (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighb

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050036	hsa-miR-27a-3p	CLASH	23622248
MIRT048132	hsa-miR-197-3p	CLASH	23622248
MIRT046894	hsa-miR-221-3p	CLASH	23622248
MIRT046082	hsa-miR-125b-5p	CLASH	23622248
MIRT045749	hsa-miR-125a-5p	CLASH	23622248
MIRT038030	hsa-miR-423-5p	CLASH	23622248
MIRT037769	hsa-miR-450b-5p	CLASH	23622248
MIRT036383	hsa-miR-1229-3p	CLASH	23622248
MIRT052795	hsa-miR-3176	CLASH	23622248
MIRT472113	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT472112	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT472111	hsa-miR-4257	PAR-CLIP	23592263
MIRT472110	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT472109	hsa-miR-1292-3p	PAR-CLIP	23592263
MIRT472108	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT472107	hsa-miR-558	PAR-CLIP	23592263
MIRT472106	hsa-miR-4487	PAR-CLIP	23592263
MIRT472105	hsa-miR-1827	PAR-CLIP	23592263
MIRT472104	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT472103	hsa-miR-6086	PAR-CLIP	23592263
MIRT472102	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT472101	hsa-miR-3612	PAR-CLIP	23592263
MIRT472100	hsa-miR-650	PAR-CLIP	23592263
MIRT472098	hsa-miR-4792	PAR-CLIP	23592263
MIRT472099	hsa-miR-4710	PAR-CLIP	23592263
MIRT472097	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT735945	hsa-miR-100-3p	Immunoprecipitaion (IP)	31694930
MIRT472113	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT472112	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT472111	hsa-miR-4257	PAR-CLIP	23592263
MIRT472110	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT472109	hsa-miR-1292-3p	PAR-CLIP	23592263
MIRT472108	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT472107	hsa-miR-558	PAR-CLIP	23592263
MIRT472106	hsa-miR-4487	PAR-CLIP	23592263
MIRT472105	hsa-miR-1827	PAR-CLIP	23592263
MIRT472104	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT472103	hsa-miR-6086	PAR-CLIP	23592263
MIRT472102	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT472101	hsa-miR-3612	PAR-CLIP	23592263
MIRT472100	hsa-miR-650	PAR-CLIP	23592263
MIRT472098	hsa-miR-4792	PAR-CLIP	23592263
MIRT472099	hsa-miR-4710	PAR-CLIP	23592263
MIRT472097	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT1187546	hsa-miR-1	CLIP-seq
MIRT1187547	hsa-miR-186	CLIP-seq
MIRT1187548	hsa-miR-206	CLIP-seq
MIRT1187549	hsa-miR-224	CLIP-seq
MIRT1187550	hsa-miR-3152-5p	CLIP-seq
MIRT1187551	hsa-miR-3163	CLIP-seq
MIRT1187552	hsa-miR-3673	CLIP-seq
MIRT1187553	hsa-miR-4423-5p	CLIP-seq
MIRT1187554	hsa-miR-4709-3p	CLIP-seq
MIRT1187555	hsa-miR-613	CLIP-seq
MIRT1187556	hsa-miR-182	CLIP-seq
MIRT1187557	hsa-miR-2115	CLIP-seq
MIRT1187558	hsa-miR-4470	CLIP-seq
MIRT1187546	hsa-miR-1	CLIP-seq
MIRT2054299	hsa-miR-1252	CLIP-seq
MIRT1187556	hsa-miR-182	CLIP-seq
MIRT2054300	hsa-miR-198	CLIP-seq
MIRT1187548	hsa-miR-206	CLIP-seq
MIRT1187557	hsa-miR-2115	CLIP-seq
MIRT1187549	hsa-miR-224	CLIP-seq
MIRT1187550	hsa-miR-3152-5p	CLIP-seq
MIRT2054301	hsa-miR-329	CLIP-seq
MIRT2054302	hsa-miR-362-3p	CLIP-seq
MIRT2054303	hsa-miR-3657	CLIP-seq
MIRT1187552	hsa-miR-3673	CLIP-seq
MIRT1187553	hsa-miR-4423-5p	CLIP-seq
MIRT1187558	hsa-miR-4470	CLIP-seq
MIRT2054304	hsa-miR-4669	CLIP-seq
MIRT2054305	hsa-miR-4685-5p	CLIP-seq
MIRT1187554	hsa-miR-4709-3p	CLIP-seq
MIRT1187555	hsa-miR-613	CLIP-seq
MIRT1187546	hsa-miR-1	CLIP-seq
MIRT1187556	hsa-miR-182	CLIP-seq
MIRT1187547	hsa-miR-186	CLIP-seq
MIRT2054300	hsa-miR-198	CLIP-seq
MIRT1187548	hsa-miR-206	CLIP-seq
MIRT1187557	hsa-miR-2115	CLIP-seq
MIRT1187549	hsa-miR-224	CLIP-seq
MIRT1187550	hsa-miR-3152-5p	CLIP-seq
MIRT1187551	hsa-miR-3163	CLIP-seq
MIRT2054301	hsa-miR-329	CLIP-seq
MIRT2054302	hsa-miR-362-3p	CLIP-seq
MIRT2054303	hsa-miR-3657	CLIP-seq
MIRT1187552	hsa-miR-3673	CLIP-seq
MIRT1187553	hsa-miR-4423-5p	CLIP-seq
MIRT1187558	hsa-miR-4470	CLIP-seq
MIRT2054304	hsa-miR-4669	CLIP-seq
MIRT2054305	hsa-miR-4685-5p	CLIP-seq
MIRT1187554	hsa-miR-4709-3p	CLIP-seq
MIRT1187555	hsa-miR-613	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001216	Function	DNA-binding transcription activator activity	IDA	8392752
GO:0001726	Component	Ruffle	IDA	11919189
GO:0001726	Component	Ruffle	IEA
GO:0003677	Function	DNA binding	IDA	11121025, 19435876
GO:0003677	Function	DNA binding	IEA
GO:0004518	Function	Nuclease activity	IDA	19435876
GO:0004550	Function	Nucleoside diphosphate kinase activity	IBA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	1851158, 9488696, 16313181, 25679041
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0004673	Function	Protein histidine kinase activity	IDA	17157250
GO:0004673	Function	Protein histidine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11919189, 16169070, 17314099, 17532299, 21988832, 24970086, 27499296, 31980649, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	15703214, 17532299
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	IDA	11919189
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006183	Process	GTP biosynthetic process	ISS
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0007155	Process	Cell adhesion	TAS	11919189
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	11919189
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IDA	1851158, 25679041
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IEA
GO:0016301	Function	Kinase activity	IDA	8529641
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019003	Function	GDP binding	IMP	19435876
GO:0030027	Component	Lamellipodium	IDA	11919189
GO:0030027	Component	Lamellipodium	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	21988832, 33961781
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16862176
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IMP	16862176
GO:0045682	Process	Regulation of epidermis development	IMP	16862176
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	8392752
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19435876
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15703214
GO:0046042	Process	ITP biosynthetic process	IDA	1851158
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	16862176
GO:0051880	Function	G-quadruplex DNA binding	IDA	19033359, 19435876, 25679041
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 23533145
GO:0071944	Component	Cell periphery	IDA	11919189
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000144	Process	Positive regulation of DNA-templated transcription initiation	IDA	19033359, 19435876

Other IDs

• MIM: 156491
• HGNC: 7850
• e!Ensembl: ENSG00000243678

Protein

• UniProt ID: P22392
• Protein name: Nucleoside diphosphate kinase B (NDK B) (NDP kinase B) (EC 2.7.4.6) (C-myc purine-binding transcription factor PUF) (Histidine protein kinase NDKB) (EC 2.7.13.3) (nm23-H2)
• Protein function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regul
• PDB: 1NSK, 1NUE, 3BBB, 3BBC, 3BBF, 7KPF, 8PIE, 8PYW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00334	NDK	5 → 139	Nucleoside diphosphate kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Ubiquitously expressed. {ECO:0000269|PubMed:16442775}.; TISSUE SPECIFICITY: [Isoform 3]: Ubiquitously expressed. {ECO:0000269|PubMed:16442775}.
• Sequence:

  MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF
  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
  DSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

• Sequence length: 152

Pathways

KEGG:

Purine metabolism
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Nucleotide metabolism
Biosynthesis of cofactors

Reactome:

Interconversion of nucleotide di- and triphosphates
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	7515452		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17272673		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17272673		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17272673	Inhibit	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	7907945		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	7614395		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18586674, 25454514, 29475390, 8102131		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19544670, 21738817, 29475390	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	7768941	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	8418304		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39207047	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	7614395		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25249619, 25906011		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	7614395	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	8460637		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25277864		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	37598400	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	8418304		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	8418304		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15814641		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29475390, 8549951		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15814641		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28717007, 29475390, 8549951	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21504894		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16862176		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	25900369, 30002415		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	31250368		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	12200143		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	7542225		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	28717007		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9334657		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30095224		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30095224		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	9490665		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	39207047	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	9615786		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12007505		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	7612661	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	9649149	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	8896423		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22192927, 29562234, 7530600, 8168032		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	39207047	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	37598400	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18586674, 25454514, 29475390, 8102131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25249619, 25906011		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	15674352		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	7907945, 8460637		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29475390		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	7614395		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15079086, 25370864, 25906011, 28128954, 31250368, 31260268, 7669582, 8102131, 8375920		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31287738, 8418304		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	1988104		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	39251709	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10400630, 31462745	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11058869, 22699362, 28715002, 7794272		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	15920167		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	Pubtator	19662092	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	15920167	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	7515452		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18496563, 22251158, 8896423, 9490665		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10499292, 15674352, 16442775, 18496563, 21556888, 22192927, 23021215, 25249619, 28715002, 29956840, 31441682, 7497458, 7515452, 7614395, 7669582, 7745027, 8375920, 8384356, 8637723, 9036878		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10400630	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11960382, 16442775, 8637723		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	8375920		★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29630434, 29956840		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29630434	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	15674352		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	8460637, 8636741		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	7669582	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	7693635	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16862176		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21504894		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	7794272		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10632374, 18665757		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	8375920		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	18665757		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29475390		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25700270, 29475390	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	7614395	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28767310		★☆☆☆☆ Found in Text Mining only