Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4830
Gene name	NME/NM23 nucleoside diphosphate kinase 1
Gene symbol	NME1
Synonyms (NCBI Gene)	AWDGAADNBNBSNDKANDPK-ANDPKANM23NM23-H1
Chromosome	17
Chromosome location	17q21.33
Summary	This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of `A` (encoded by this gene) and `B` (encoded by NME2) isoforms. Mutations in this

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments
MIRT1187500	hsa-miR-1193	CLIP-seq
MIRT1187501	hsa-miR-1245b-3p	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187505	hsa-miR-146a	CLIP-seq
MIRT1187506	hsa-miR-146b-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187508	hsa-miR-1913	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187511	hsa-miR-3173-3p	CLIP-seq
MIRT1187512	hsa-miR-3192	CLIP-seq
MIRT1187513	hsa-miR-324-3p	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187515	hsa-miR-346	CLIP-seq
MIRT1187516	hsa-miR-3607-3p	CLIP-seq
MIRT1187517	hsa-miR-3685	CLIP-seq
MIRT1187518	hsa-miR-3689a-3p	CLIP-seq
MIRT1187519	hsa-miR-3689c	CLIP-seq
MIRT1187520	hsa-miR-384	CLIP-seq
MIRT1187521	hsa-miR-3908	CLIP-seq
MIRT1187522	hsa-miR-3909	CLIP-seq
MIRT1187523	hsa-miR-4270	CLIP-seq
MIRT1187524	hsa-miR-4290	CLIP-seq
MIRT1187525	hsa-miR-4441	CLIP-seq
MIRT1187526	hsa-miR-4527	CLIP-seq
MIRT1187527	hsa-miR-4533	CLIP-seq
MIRT1187528	hsa-miR-4641	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187531	hsa-miR-4694-3p	CLIP-seq
MIRT1187532	hsa-miR-4728-3p	CLIP-seq
MIRT1187533	hsa-miR-4728-5p	CLIP-seq
MIRT1187534	hsa-miR-4731-5p	CLIP-seq
MIRT1187535	hsa-miR-4747-5p	CLIP-seq
MIRT1187536	hsa-miR-4764-5p	CLIP-seq
MIRT1187537	hsa-miR-4779	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187539	hsa-miR-542-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187505	hsa-miR-146a	CLIP-seq
MIRT1187506	hsa-miR-146b-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187508	hsa-miR-1913	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187511	hsa-miR-3173-3p	CLIP-seq
MIRT1187512	hsa-miR-3192	CLIP-seq
MIRT1187513	hsa-miR-324-3p	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187517	hsa-miR-3685	CLIP-seq
MIRT1187518	hsa-miR-3689a-3p	CLIP-seq
MIRT1187519	hsa-miR-3689c	CLIP-seq
MIRT1187520	hsa-miR-384	CLIP-seq
MIRT1187522	hsa-miR-3909	CLIP-seq
MIRT1187523	hsa-miR-4270	CLIP-seq
MIRT1187525	hsa-miR-4441	CLIP-seq
MIRT1187527	hsa-miR-4533	CLIP-seq
MIRT1187528	hsa-miR-4641	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187532	hsa-miR-4728-3p	CLIP-seq
MIRT1187533	hsa-miR-4728-5p	CLIP-seq
MIRT1187534	hsa-miR-4731-5p	CLIP-seq
MIRT1187535	hsa-miR-4747-5p	CLIP-seq
MIRT1187537	hsa-miR-4779	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187500	hsa-miR-1193	CLIP-seq
MIRT1187501	hsa-miR-1245b-3p	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187505	hsa-miR-146a	CLIP-seq
MIRT1187506	hsa-miR-146b-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187512	hsa-miR-3192	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187516	hsa-miR-3607-3p	CLIP-seq
MIRT1187518	hsa-miR-3689a-3p	CLIP-seq
MIRT1187519	hsa-miR-3689c	CLIP-seq
MIRT1187523	hsa-miR-4270	CLIP-seq
MIRT1187525	hsa-miR-4441	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187532	hsa-miR-4728-3p	CLIP-seq
MIRT1187533	hsa-miR-4728-5p	CLIP-seq
MIRT1187534	hsa-miR-4731-5p	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187539	hsa-miR-542-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187500	hsa-miR-1193	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187539	hsa-miR-542-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187516	hsa-miR-3607-3p	CLIP-seq
MIRT1187517	hsa-miR-3685	CLIP-seq
MIRT1187520	hsa-miR-384	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
STAT3	Activation	23583378
TP53	Unknown	12669312

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	11555662
GO:0003677	Function	DNA binding	IDA	14960567
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004520	Function	DNA endonuclease activity	IDA	11694515, 12628186, 16818237
GO:0004536	Function	DNA nuclease activity	IDA	11555662
GO:0004550	Function	Nucleoside diphosphate kinase activity	IBA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	1851158, 8810265, 9488696, 12972261, 16313181, 19956735, 23519676, 33903070
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0004673	Function	Protein histidine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	10602478, 11701125, 15684389, 16189514, 16818237, 17314099, 17906697, 17975005, 18470881, 19060904, 21653829, 21988832, 25416956, 27499296, 31515488, 31980649, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	2509941, 16313181, 16814409
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005737	Component	Cytoplasm	IDA	2509941
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005769	Component	Early endosome	IDA	37267906
GO:0005829	Component	Cytosol	IDA	16814409
GO:0005829	Component	Cytosol	TAS
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0006308	Process	DNA catabolic process	IDA	11694515, 14960567, 16313181
GO:0006309	Process	Apoptotic DNA fragmentation	IDA	12628186, 16818237
GO:0006720	Process	Isoprenoid metabolic process	IDA	10952986
GO:0006897	Process	Endocytosis	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007595	Process	Lactation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1851158
GO:0008296	Function	3'-5'-DNA exonuclease activity	IDA	14960567, 16313181
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009132	Process	Nucleoside diphosphate metabolic process	IDA	19956735, 23519676, 33903070
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IDA	8810265, 19956735, 23519676, 33903070
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IDA	8529641
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016776	Function	Phosphotransferase activity, phosphate group as acceptor	IDA	10952986
GO:0019003	Function	GDP binding	IDA	12972261
GO:0030154	Process	Cell differentiation	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0032587	Component	Ruffle membrane	IDA	16814409
GO:0034214	Process	Protein hexamerization	IDA	11835509
GO:0042304	Process	Regulation of fatty acid biosynthetic process	ISS
GO:0042802	Function	Identical protein binding	IPI	10602478, 16189514, 17314099, 25416956, 25502805, 25910212, 31515488, 32296183
GO:0042981	Process	Regulation of apoptotic process	TAS	16130169
GO:0043024	Function	Ribosomal small subunit binding	IPI	16814409
GO:0043531	Function	ADP binding	IDA	12972261, 16944299
GO:0046042	Process	ITP biosynthetic process	IDA	1851158
GO:0046356	Process	Acetyl-CoA catabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0047887	Function	Farnesyl diphosphate kinase activity	IDA	10952986
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	16862176
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0120225	Function	Coenzyme A binding	ISS
GO:0120226	Function	Succinyl-CoA binding	ISS
GO:1905502	Function	Acetyl-CoA binding	ISS

MIM	HGNC	e!Ensembl
156490	7849	ENSG00000239672

P15531

Protein name

Nucleoside diphosphate kinase A (NDK A) (NDP kinase A) (EC 2.7.4.6) (Granzyme A-activated DNase) (GAAD) (Metastasis inhibition factor nm23) (NM23-H1) (Tumor metastatic process-associated protein)

Protein function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate

PDB

1JXV , 1UCN , 2HVD , 2HVE , 3L7U , 4ENO , 5UI4 , 8OOV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00334	NDK	5 → 139	Nucleoside diphosphate kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression

Sequence

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Sequence length

152

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors		Interconversion of nucleotide di- and triphosphates

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (297)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8058309, 8896423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11299850, 12153176, 9891483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	8058309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	8896423, 9490665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	8058309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10792783, 16425351, 16829691, 7736397, 7916650, 7981087, 8199988, 8383029, 8569178, 8892585, 9196297, 9594287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12910292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15563674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	16425351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	9196297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	8738406, 8892585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	9615752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	15757202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29589313, 7745027, 8273382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	7510345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12153176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25311278, 30268934, 36142676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	8394105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	8394105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	8660103	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39217320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17057884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	16891807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	9271379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30268934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30268934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	15073128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16829691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	17436409, 7745027, 7907945, 8900377, 9413204, 9824622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	8618340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biotinidase Deficiency	Biotinidase Deficiency	BEFREE	19757147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10999750, 11326661, 7614395, 9891471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	36293204	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	7593131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	7593131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15592684, 8641989	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10332871, 10619258, 10628350, 11063804, 11179491, 11280768, 11280805, 11687967, 11744991, 11796500, 11918081, 12174914, 12234027, 1356624, 15280446 View all (54 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10082974, 1356959, 15592684, 15684389, 1714241, 17591363, 18676749, 21738817, 21838876, 22290468, 22451184, 23818346, 29203642, 31839604, 33402463 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11694515, 12163590, 16415009, 16631833, 17695492, 25048347, 28991262, 33436746, 8394105	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	12515726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16415009, 20448457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16415009	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	BEFREE	11115597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12801264, 17359290, 32795291, 9569056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10403901, 11337376, 11502841, 12684753, 1394207, 14639604, 15040016, 16005711, 17197349, 18949358, 18996649, 25048347, 29953715, 7513249, 8096503 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	1714241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	1714241, 23725501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15761980, 20841469, 25472720, 29271183, 35438846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	20841469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	1714241	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10999750, 11326661, 7614395, 9891471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	16531762, 30683471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10219898, 10512675, 10629490, 16425351, 17688968, 18440302, 19331130, 2015608, 21769563, 23137649, 28781685, 28831131, 29541242, 29970055, 30655894 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10817501, 12950146, 7669582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20515575, 7614395, 8593205, 9341897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17359290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25428551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	8156496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10817501, 11943895, 16445634, 22683585, 23524894, 27082164, 29274004, 7622307, 7669582, 7907945, 8098014, 8636741, 8702236, 8900377, 9594287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	9110298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28134327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	16254002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	36430274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29697269		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16537673, 8394105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	16537673, 17359290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10880723, 11518746, 16537673, 18668641, 7736397, 8394105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11299850, 12153176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29271183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	12484649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	7593131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11408732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	18949358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14639604, 15563674, 17695492, 17952613, 20841469, 27449069, 7554087, 7819128, 7819583, 8394105, 8418304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	20841469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15334673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15563674, 2023273, 20841469, 8418304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15563674, 16425351, 20841469, 7981087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10719723, 11571982, 12474051, 12684753, 14973550, 1679868, 2015608, 26634527, 27888614, 28123532, 29589313, 7916650, 7947079, 7981087, 8033126 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15814641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10450731, 15334673, 15563674, 16554912, 17278192, 19125701, 21225146, 23679306, 27888614, 29700912, 7947079, 7947085, 7981087, 8217591, 8549951	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12474051, 12684753, 14664140		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12684753, 8084595		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15814641		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27222072	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Comedone	Comedone	BEFREE	7513249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	12051871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15882758, 9341897, 9615786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	8843913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystathionine beta-Synthase Deficiency Disease	Cystathionine Beta-Synthase Deficiency Disease	BEFREE	19836982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29251738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of butyryl-CoA dehydrogenase	Deficiency Of Butyryl-CoA Dehydrogenase	BEFREE	24485985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16862176, 28724394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10611312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10611312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31275749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	11502841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12153176, 16891807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive System Neoplasms	LHGDN	18810774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	18810774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive System Neoplasms	BEFREE	27518571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	12200143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	10403901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	9094461		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	30827726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20599259, 8156496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30827726, 8855975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23856325, 24133580, 9458291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24133580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16445634, 22683585, 7622307, 9594287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17708612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10507772, 11027435, 11319942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	7542225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye Neoplasms	BEFREE	9195562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	18838476		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	18838476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	18996649, 8273382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	11502841, 18996649, 25048347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28194091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19152459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19152459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9334657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	12051871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17057884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17057884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11082283, 16475705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16475705	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17057884, 33721446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	10211889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	15242782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	10910925, 16232196	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12153176, 16232196, 29407582, 9490665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	8855975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16891807, 8956779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18647967, 8956779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	11408732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	15228429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	11408732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	9527842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	9527842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertyrosinemia	Hypertyrosinemia	BEFREE	28724394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	23647800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	31186694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	31734851		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	18510707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	21913743, 9824622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	21846466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	9615786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	7614395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	17167724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	9555115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29187211, 29953715, 30683471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	9555115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	16330948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10910925, 1311721, 7612661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12007505, 12137595		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19655221, 19664043, 8058309, 8555463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	9490665	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10910925, 1311721, 33284559, 9490665, 9649149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12153176, 19655221, 19664043, 22035418, 8896423, 9490665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	30448004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10374394, 10664247, 10972975, 15761980, 16140886, 16944304, 17671192, 20618991, 20841469, 21562815, 22192927, 29271183, 29562234, 30662464, 7530600 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	20841469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20841469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	10450731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20841469, 8039626, 9658316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17688968, 18440302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29970055, 32795291, 7928630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	8569178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15040016, 15150613, 15334673, 16425351, 16554912, 22903495, 23679306, 23725501, 24858271, 32795291, 7669582, 7903963, 7981081, 8924224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17504447, 18810774, 29187211	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29187211, 7736397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12153176, 28991262, 8555463, 8956779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	14616965, 28991262, 8956779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16891807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18647967	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12153176, 8956779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12153176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	16891807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10619258, 10628350, 11063804, 11179491, 11280768, 11744991, 12174914, 12234027, 1356624, 1356959, 15671547, 16005711, 16317582, 16468415, 16531762 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20599259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11027435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28194091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	7614395, 7776445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	11445859, 9616278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25872475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16425351, 17688968, 18440302, 19331130, 21769563, 23137649, 28781685, 28831131, 29541242, 29970055, 30655894, 30763256, 7497458, 8375920, 8893591, 9066685, 9080143 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10817501, 11768314, 11943895, 14981979, 23524894, 27082164, 29274004, 7622307, 7669582, 7780979, 7907945, 8098014, 8636741, 8702236, 8900377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11331321, 8383029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21553004, 25138575, 30675295, 8118821, 8738406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11675153, 11741739, 11848537, 15726650, 17695492, 22903495, 28401162, 30249868, 8293386, 9443089, 9652789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10999750, 11326661, 7614395, 9891471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10794547, 10999750, 11172604, 11331321, 11337376, 11675153, 11768314, 12669312, 12848344, 1356624, 14601090, 14735469, 14998490, 16140886, 16425351 View all (59 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16537673, 8394105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11032947, 14639604, 15563674, 17695492, 17952613, 27449069, 7819583, 8394105, 8418304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	9036878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12174914, 15592684, 15870434, 17591363, 18089805, 18676749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	1988104, 1994057, 2475243, 7970728, 9036878, 9070493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16891807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	BEFREE	28724394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	8273382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	39251709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	9094461		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11058869, 11337376, 11744991, 11768314, 1356624, 16277028, 16440314, 17039395, 17197349, 20209495, 21448569, 21553004, 21713383, 21912348, 22699362 View all (32 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11694515, 28991262, 8394105	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16277028, 17885583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19152459, 25048347, 25808322, 30396920, 31462745, 32824412, 7981081, 8648172, 8855975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	9413204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	19662092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24485985, 28054209, 28724394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	7728768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	7515452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	20145075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34876614	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	BEFREE	23837464		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12153176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10910925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	9490665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12153176, 18496563, 8896423, 9490665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18219290, 28614246, 30389538, 9842967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10203660, 10332871, 10481784, 10523705, 10629490, 10794547, 10880723, 10914829, 10972975, 10999750, 11115597, 11172604, 11179491, 11223831, 11280768 View all (146 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10400630, 10928103, 11687967, 11960382, 12859952, 15280446, 16232196, 16442775, 17155928, 17197349, 2056128, 21484438, 21553004, 23448979, 25138575 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10400630, 16232196, 16442775, 17155928, 19186179, 2056128, 21573212, 22328561, 28991262, 8932344, 9038158, 9188446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	8011699, 8648172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	19414372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nicolaides Baraitser syndrome	Nicolaides Baraitser Syndrome	BEFREE	30608175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	16840438, 19635536, 30608175, 9271379, 9634525, 9650762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15777972, 17167724, 17549350, 17688968, 20671611, 30763256, 8375920, 9932606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	16425351, 7513249, 9824622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17197349, 17975005, 25138575, 7593131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	7593131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23524894, 7669582, 7907945, 8702236, 8900377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	19152459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10817501, 11943895, 27082164, 29274004, 7622307, 7763042, 7780979, 8098014, 8636741, 8702236, 8900377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10631462, 10817501, 12950146, 17433065, 18408655, 19152459, 19487548, 21469425, 7669582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	18949358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11331321, 8383029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11032947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18996649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	11197119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	10211889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pfaundler-Hurler Syndrome	Pfaundler-Hurler Syndrome	BEFREE	23837464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	28724394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	31734851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	31507590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10072163, 21553004, 25138575, 30675295, 7510345, 8118821, 8738406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	7693635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	8738406, 8892585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24858271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16862176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	9615752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	7776445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15882758, 9341897, 9615786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	15512982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	8156496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28134327, 8660103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11687967, 31186694, 9099969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	9099969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	21270158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10332871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	8389529	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	7794272, 9085150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	10219898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10373649, 10629490, 10632374, 11337376, 15150613, 16531762, 16537673, 17359290, 20101217, 7863493, 8174043, 8358113, 8375920, 8569178, 9080143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11319942, 15568401, 15645378, 16531762, 16739125, 17918157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10507772, 11027435, 11319942, 15296908, 19664078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11337376, 15150613, 25277180, 29187211, 35655921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	7863493, 8375920, 9066685, 9080143, 9297629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10629490, 10794547, 11439361, 21509763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	19263457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	BEFREE	8358113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	31186694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11675153, 11741739, 11848537, 15040016, 15726650, 17695492, 22903495, 28401162, 30249868, 8293386, 9443089, 9652789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12452062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15040016, 16425351, 17504447, 17532757, 17695492, 20205286, 22799386, 22903495, 23725501, 37402315, 7902105, 8096503, 8641989, 8924224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	11223831, 9099969		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16891807		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	8735718, 8859190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	8389529	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17197349, 18996649, 25048347, 8273382, 8394105, 8396479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	8394105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	18996649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	8273382, 8396479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25048347, 8030752, 8394105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	10999750, 8735718, 8859190, 9891471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	10403901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	10999750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosinemias	Tyrosinemia	BEFREE	28724394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19171060, 7614395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16537673	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16537673, 17359290, 26716410, 8855975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	8855975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	17885583, 8843913, 9195562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	34782661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28767310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	8617458		★★★★★ ★☆☆☆☆ Found in Text Mining only

NME1 (NME/NM23 nucleoside diphosphate kinase 1)