NMB (neuromedin B)

Gene

• Entrez ID: 4828
• Gene name: Neuromedin B
• Gene symbol: NMB
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q25.2
• Summary: This gene encodes a member of the bombesin-like family of neuropeptides, which negatively regulate eating behavior. The encoded protein may regulate colonic smooth muscle contraction through binding to its cognate receptor, the neuromedin B receptor (NMBR

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1187346	hsa-miR-421	CLIP-seq
MIRT1187347	hsa-miR-4272	CLIP-seq
MIRT1187348	hsa-miR-4709-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005179	Function	Hormone activity	TAS	2458345
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0007165	Process	Signal transduction	TAS	2458345
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	2458345
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0031710	Function	Neuromedin B receptor binding	IBA
GO:0031710	Function	Neuromedin B receptor binding	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032727	Process	Positive regulation of interferon-alpha production	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0046887	Process	Positive regulation of hormone secretion	IBA
GO:0046887	Process	Positive regulation of hormone secretion	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0050482	Process	Arachidonate secretion	IEA
GO:0090290	Process	Positive regulation of osteoclast proliferation	ISS
GO:0140374	Process	Antiviral innate immune response	ISS
GO:0160023	Process	Sneeze reflex	IBA
GO:0160023	Process	Sneeze reflex	ISS
GO:0160024	Process	Leydig cell proliferation	ISS
GO:0160025	Process	Sensory perception of itch	ISS
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	ISS
GO:2000845	Process	Positive regulation of testosterone secretion	ISS

Other IDs

• MIM: 162340
• HGNC: 7842
• e!Ensembl: ENSG00000197696

Protein

• UniProt ID: P08949
• Protein name: Neuromedin-B [Cleaved into: Neuromedin-B-32; Neuromedin-B]
• Protein function: Stimulates smooth muscle contraction (By similarity). Induces sighing by acting directly on the pre-Botzinger complex, a cluster of several thousand neurons in the ventrolateral medulla responsible for inspiration during respiratory activity (By
• PDB: 1C98, 1C9A, 8H0P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02044	Bombesin	47 → 60	Bombesin-like peptide	Family

• Sequence:

  MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKS
  LEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQ
  K

• Sequence length: 121

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRURITUS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations