NNAT (neuronatin)

Gene

• Entrez ID: 4826
• Gene name: Neuronatin
• Gene symbol: NNAT
• Synonyms (NCBI Gene): Peg5
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054416	hsa-miR-198	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24519663
MIRT054416	hsa-miR-198	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24519663
MIRT054899	hsa-miR-708-5p	Luciferase reporter assay	23328481
MIRT054899	hsa-miR-708-5p	Luciferase reporter assay	23328481
MIRT054899	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR, Western blot	26075749
MIRT1188113	hsa-miR-1285	CLIP-seq
MIRT1188114	hsa-miR-149	CLIP-seq
MIRT1188115	hsa-miR-1539	CLIP-seq
MIRT1188116	hsa-miR-2277-3p	CLIP-seq
MIRT1188117	hsa-miR-2277-5p	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT1188119	hsa-miR-296-5p	CLIP-seq
MIRT1188120	hsa-miR-3074-5p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188122	hsa-miR-3187-5p	CLIP-seq
MIRT1188123	hsa-miR-3193	CLIP-seq
MIRT1188124	hsa-miR-3202	CLIP-seq
MIRT1188125	hsa-miR-323-5p	CLIP-seq
MIRT1188126	hsa-miR-339-5p	CLIP-seq
MIRT1188127	hsa-miR-3667-3p	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT1188129	hsa-miR-4281	CLIP-seq
MIRT1188130	hsa-miR-4425	CLIP-seq
MIRT1188131	hsa-miR-4475	CLIP-seq
MIRT1188132	hsa-miR-4479	CLIP-seq
MIRT1188133	hsa-miR-4490	CLIP-seq
MIRT1188134	hsa-miR-4667-3p	CLIP-seq
MIRT1188135	hsa-miR-4667-5p	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188137	hsa-miR-4700-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT1188139	hsa-miR-4747-5p	CLIP-seq
MIRT1188140	hsa-miR-4774-5p	CLIP-seq
MIRT1188141	hsa-miR-612	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq
MIRT1188144	hsa-miR-892b	CLIP-seq
MIRT2054522	hsa-miR-19a	CLIP-seq
MIRT2054523	hsa-miR-19b	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT2054524	hsa-miR-3130-3p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT2054525	hsa-miR-3936	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT2054526	hsa-miR-518a-5p	CLIP-seq
MIRT2054527	hsa-miR-527	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	TAS	8813377
GO:0009249	Process	Protein lipoylation	TAS	8813377
GO:0032024	Process	Positive regulation of insulin secretion	IBA

Other IDs

• MIM: 603106
• HGNC: 7860
• e!Ensembl: ENSG00000053438

Protein

• UniProt ID: Q16517
• Protein name: Neuronatin
• Protein function: May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
• Sequence:

  MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
  AYTVSRTGRQVLGERRQRAPN

• Sequence length: 81

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	11960906		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17805055		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17805055		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17805055		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18701710		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	30814928		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	30933048		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	37630847, 37987927	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28710004		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28540450, 31165373		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37400769	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17805055	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18701710		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24345642		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24345642		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	30933048		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23508900		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	27730449		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22624064	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21779398		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	21742036, 23408434, 24345642		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora disease	Pubtator	23408434	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11960906		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	11960906		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11960906		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	24345474	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	24345474	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	24345474		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	BEFREE	24345474		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17210712		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28540450, 31165373		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18701710, 24345642		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18701710		★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	11960906		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	24345474		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12526712, 17762496, 17805055, 19218280, 23508900, 23825673, 24345474, 28181547		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	23825673		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17762496, 18082705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	CTD_human_DG	17762496		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	39217334	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24345642		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17043644		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17805055		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24158121	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29864031, 30279096		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37630847	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31165373		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28710004		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28181547		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28710004		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17409960		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17805055		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28351298	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	12057921, 23825673	Associate	★☆☆☆☆ Found in Text Mining only