NKG7 (natural killer cell granule protein 7)

Gene

• Entrez ID: 4818
• Gene name: Natural killer cell granule protein 7
• Gene symbol: NKG7
• Synonyms (NCBI Gene): GIG1, GMP-17, p15-TIA-1
• Chromosome: 19
• Chromosome location: 19q13.41

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017811	hsa-miR-335-5p	Microarray	18185580
MIRT1186236	hsa-miR-1245b-3p	CLIP-seq
MIRT1186237	hsa-miR-2467-5p	CLIP-seq
MIRT1186238	hsa-miR-4740-3p	CLIP-seq
MIRT1186239	hsa-miR-499a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002420	Process	Natural killer cell mediated cytotoxicity directed against tumor cell target	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005764	Component	Lysosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8570616
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8458737
GO:0006954	Process	Inflammatory response	IEA
GO:0016020	Component	Membrane	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0035710	Process	CD4-positive, alpha-beta T cell activation	ISS
GO:0042267	Process	Natural killer cell mediated cytotoxicity	ISS
GO:0042832	Process	Defense response to protozoan	IDA	32839608
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043320	Process	Natural killer cell degranulation	ISS
GO:0044194	Component	Cytolytic granule	IEA
GO:0044194	Component	Cytolytic granule	ISS
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0101004	Component	Cytolytic granule membrane	IDA	8570616
GO:0101004	Component	Cytolytic granule membrane	IEA
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	ISS

Other IDs

• MIM: 606008
• HGNC: 7830
• e!Ensembl: ENSG00000105374

Protein

• UniProt ID: Q16617
• Protein name: Protein NKG7 (G-CSF-induced gene 1 protein) (GIG-1 protein) (Granule membrane protein of 17 kDa) (GMP-17) (Natural killer cell protein 7) (p15-TIA-1)
• Protein function: Regulates cytotoxic granule exocytosis in effector lymphocytes, thus acting as a critical mediator of inflammation in a broad range of infectious and non-infectious diseases (By similarity). Essential for cytotoxic degranulation of natural kille
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	1 → 150	PMP-22/EMP/MP20/Claudin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in activated T-cells, in kidney, liver, lung and pancreas. Not expressed in brain, heart, or skeletal muscle. Expressed at high levels in TCR gamma delta-expressing CTL clones, and in some TCR alpha beta-expressing CTL clones
• Sequence:

  MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQT
  FSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQP
  PHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL

• Sequence length: 165

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	35817495, 37730635	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39363164	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34777632	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35626661	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	18354379	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	9886253		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9886253		★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	27424220		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34393665	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	16914566		★☆☆☆☆ Found in Text Mining only