Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4815
Gene name	Ninjurin 2
Gene symbol	NINJ2
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12p13.33
Summary	The protein encoded by this gene belongs to the ninjurin (for nerve injury induced) family. It is a cell surface adhesion protein that is upregulated in Schwann cells surrounding the distal segment of injured nerve, and promotes neurite outgrowth, thus ma

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments
MIRT1185162	hsa-miR-1252	CLIP-seq
MIRT1185163	hsa-miR-298	CLIP-seq
MIRT1185164	hsa-miR-338-3p	CLIP-seq
MIRT1185165	hsa-miR-3664-3p	CLIP-seq
MIRT1185166	hsa-miR-4254	CLIP-seq
MIRT1185167	hsa-miR-4426	CLIP-seq
MIRT1185168	hsa-miR-4436a	CLIP-seq
MIRT1185169	hsa-miR-4468	CLIP-seq
MIRT1185170	hsa-miR-4476	CLIP-seq
MIRT1185171	hsa-miR-4519	CLIP-seq
MIRT1185172	hsa-miR-4530	CLIP-seq
MIRT1185173	hsa-miR-4647	CLIP-seq
MIRT1185174	hsa-miR-4662b	CLIP-seq
MIRT1185175	hsa-miR-922	CLIP-seq
MIRT1185165	hsa-miR-3664-3p	CLIP-seq
MIRT2053650	hsa-miR-3670	CLIP-seq
MIRT2053651	hsa-miR-4303	CLIP-seq
MIRT1185168	hsa-miR-4436a	CLIP-seq
MIRT2581034	hsa-miR-125a-3p	CLIP-seq
MIRT2581035	hsa-miR-1321	CLIP-seq
MIRT2581036	hsa-miR-3132	CLIP-seq
MIRT2581037	hsa-miR-3162-5p	CLIP-seq
MIRT2581038	hsa-miR-34b	CLIP-seq
MIRT2581039	hsa-miR-3684	CLIP-seq
MIRT2581040	hsa-miR-3934	CLIP-seq
MIRT2581041	hsa-miR-4436b-3p	CLIP-seq
MIRT2581042	hsa-miR-4739	CLIP-seq
MIRT2581043	hsa-miR-4756-5p	CLIP-seq
MIRT2581044	hsa-miR-4764-3p	CLIP-seq
MIRT2581045	hsa-miR-4803	CLIP-seq
MIRT2581046	hsa-miR-510	CLIP-seq
MIRT2581047	hsa-miR-548c-3p	CLIP-seq
MIRT2581048	hsa-miR-764	CLIP-seq
MIRT2581034	hsa-miR-125a-3p	CLIP-seq
MIRT2581035	hsa-miR-1321	CLIP-seq
MIRT2581036	hsa-miR-3132	CLIP-seq
MIRT2581037	hsa-miR-3162-5p	CLIP-seq
MIRT1185164	hsa-miR-338-3p	CLIP-seq
MIRT2581038	hsa-miR-34b	CLIP-seq
MIRT2581039	hsa-miR-3684	CLIP-seq
MIRT2581040	hsa-miR-3934	CLIP-seq
MIRT2581041	hsa-miR-4436b-3p	CLIP-seq
MIRT1185172	hsa-miR-4530	CLIP-seq
MIRT2581042	hsa-miR-4739	CLIP-seq
MIRT2581043	hsa-miR-4756-5p	CLIP-seq
MIRT2581044	hsa-miR-4764-3p	CLIP-seq
MIRT2581045	hsa-miR-4803	CLIP-seq
MIRT2581046	hsa-miR-510	CLIP-seq
MIRT2686318	hsa-miR-532-5p	CLIP-seq
MIRT2581047	hsa-miR-548c-3p	CLIP-seq
MIRT2581048	hsa-miR-764	CLIP-seq
MIRT1185175	hsa-miR-922	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005886	Component	Plasma membrane	IDA	39667936
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10627596
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007158	Process	Neuron cell-cell adhesion	TAS	10627596
GO:0007399	Process	Nervous system development	TAS	10627596
GO:0015485	Function	Cholesterol binding	IDA	39667936
GO:0016020	Component	Membrane	IEA
GO:0019835	Process	Cytolysis	IDA	33472215, 38614101, 39667936
GO:0042246	Process	Tissue regeneration	IEA
GO:0140912	Function	Membrane destabilizing activity	IDA	33472215, 38614101, 39667936

MIM	HGNC	e!Ensembl
607297	7825	ENSG00000171840

Q9NZG7

Protein name

Ninjurin-2 (Nerve injury-induced protein 2)

Protein function

Its role in unclear (PubMed:33472215, PubMed:38614101, PubMed:39667936). In contrast to NINJ1 paralog, does not mediate plasma membrane rupture (cytolysis) downstream of necroptotic and pyroptotic programmed cell death (PubMed:33472215, PubMed:3

PDB

8SZB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04923	Ninjurin	24 → 125	Ninjurin	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. In adult, higher expression in the bone marrow and peripheral blood lymphocytes, medium in the lung, lymph node, thyroid, uterus, thymus, spleen, prostate and skeletal muscle, lower in the liver, placenta, brain, hear

Sequence

MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS
HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV
FITAFGAHKTGFLAARASRNPL

Sequence length

142

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	21674003	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28431986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28431986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34897030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	24367640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	24367640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22429733, 24664524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19369658, 21376321, 22795341, 26312640, 26687183, 26708676, 28431986, 31372770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31597121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34897030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	38512812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	21674003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	21674003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	38512812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31794427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31794427	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38512812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	21376321, 21722921, 22297388, 22795341, 24664524, 24959832, 25096477, 28431986, 30656483, 31258083, 31372770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22429733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30379917	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31292852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36360183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30379917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	22212150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	21674003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22212150, 34897030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NINJ2 (ninjurin 2)