Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4811
Gene name	Nidogen 1
Gene symbol	NID1
Synonyms (NCBI Gene)	NID
Chromosome	1
Chromosome location	1q42.3
Summary	This gene encodes a member of the nidogen family of basement membrane glycoproteins. The protein interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix. [provided by RefSeq, Ju

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs730882225	C>T	Likely-pathogenic	Splice donor variant
rs1064793217	A>T	Likely-pathogenic	Initiator codon variant, missense variant

345

Show/Hide all (345)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005669	hsa-miR-29b-3p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20971881
MIRT005669	hsa-miR-29b-3p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20971881
MIRT002921	hsa-miR-124-3p	Microarray	18668037
MIRT045142	hsa-miR-186-5p	CLASH	23622248
MIRT044313	hsa-miR-106b-5p	CLASH	23622248
MIRT456589	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT456587	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT456588	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT456586	hsa-miR-4459	PAR-CLIP	23592263
MIRT456585	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT456584	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT456583	hsa-miR-4434	PAR-CLIP	23592263
MIRT456582	hsa-miR-4516	PAR-CLIP	23592263
MIRT456581	hsa-miR-5703	PAR-CLIP	23592263
MIRT456580	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT456579	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT456578	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT456577	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT456576	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT456589	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT456587	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT456588	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT456586	hsa-miR-4459	PAR-CLIP	23592263
MIRT456585	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT456584	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT456583	hsa-miR-4434	PAR-CLIP	23592263
MIRT456582	hsa-miR-4516	PAR-CLIP	23592263
MIRT456581	hsa-miR-5703	PAR-CLIP	23592263
MIRT456580	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT456579	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT456578	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT456577	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT456576	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT1184815	hsa-miR-1224-5p	CLIP-seq
MIRT1184816	hsa-miR-1271	CLIP-seq
MIRT1184817	hsa-miR-1304	CLIP-seq
MIRT1184818	hsa-miR-182	CLIP-seq
MIRT1184819	hsa-miR-185	CLIP-seq
MIRT1184820	hsa-miR-3150b-3p	CLIP-seq
MIRT1184821	hsa-miR-3151	CLIP-seq
MIRT1184822	hsa-miR-3161	CLIP-seq
MIRT1184823	hsa-miR-3192	CLIP-seq
MIRT1184824	hsa-miR-326	CLIP-seq
MIRT1184825	hsa-miR-330-5p	CLIP-seq
MIRT1184826	hsa-miR-3545-5p	CLIP-seq
MIRT1184827	hsa-miR-3659	CLIP-seq
MIRT1184828	hsa-miR-3671	CLIP-seq
MIRT1184829	hsa-miR-3915	CLIP-seq
MIRT1184830	hsa-miR-3928	CLIP-seq
MIRT1184831	hsa-miR-3929	CLIP-seq
MIRT1184832	hsa-miR-4306	CLIP-seq
MIRT1184833	hsa-miR-4314	CLIP-seq
MIRT1184834	hsa-miR-4419b	CLIP-seq
MIRT1184835	hsa-miR-4470	CLIP-seq
MIRT1184836	hsa-miR-4478	CLIP-seq
MIRT1184837	hsa-miR-4522	CLIP-seq
MIRT1184838	hsa-miR-4644	CLIP-seq
MIRT1184839	hsa-miR-4646-5p	CLIP-seq
MIRT1184840	hsa-miR-4658	CLIP-seq
MIRT1184841	hsa-miR-4689	CLIP-seq
MIRT1184842	hsa-miR-4698	CLIP-seq
MIRT1184843	hsa-miR-4747-5p	CLIP-seq
MIRT1184844	hsa-miR-4784	CLIP-seq
MIRT1184845	hsa-miR-485-5p	CLIP-seq
MIRT1184846	hsa-miR-574-5p	CLIP-seq
MIRT1184847	hsa-miR-583	CLIP-seq
MIRT1184848	hsa-miR-767-3p	CLIP-seq
MIRT1184849	hsa-miR-9	CLIP-seq
MIRT1184850	hsa-miR-96	CLIP-seq
MIRT1551755	hsa-miR-4651	CLIP-seq
MIRT1551756	hsa-miR-581	CLIP-seq
MIRT1551757	hsa-miR-608	CLIP-seq
MIRT1556729	hsa-miR-140-5p	CLIP-seq
MIRT1184823	hsa-miR-3192	CLIP-seq
MIRT1556730	hsa-miR-4276	CLIP-seq
MIRT1184833	hsa-miR-4314	CLIP-seq
MIRT1184839	hsa-miR-4646-5p	CLIP-seq
MIRT1556731	hsa-miR-4710	CLIP-seq
MIRT1556732	hsa-miR-4762-5p	CLIP-seq
MIRT1556733	hsa-miR-4773	CLIP-seq
MIRT1551756	hsa-miR-581	CLIP-seq
MIRT2053602	hsa-miR-2052	CLIP-seq
MIRT1551755	hsa-miR-4651	CLIP-seq
MIRT1551756	hsa-miR-581	CLIP-seq
MIRT1551757	hsa-miR-608	CLIP-seq
MIRT1184827	hsa-miR-3659	CLIP-seq
MIRT1551755	hsa-miR-4651	CLIP-seq
MIRT1551757	hsa-miR-608	CLIP-seq
MIRT2431592	hsa-miR-1197	CLIP-seq
MIRT1556729	hsa-miR-140-5p	CLIP-seq
MIRT2431593	hsa-miR-197	CLIP-seq
MIRT2431594	hsa-miR-3153	CLIP-seq
MIRT1184823	hsa-miR-3192	CLIP-seq
MIRT2431595	hsa-miR-3653	CLIP-seq
MIRT2431596	hsa-miR-3658	CLIP-seq
MIRT2431597	hsa-miR-3692	CLIP-seq
MIRT2431598	hsa-miR-3945	CLIP-seq
MIRT2431599	hsa-miR-4253	CLIP-seq
MIRT1556730	hsa-miR-4276	CLIP-seq
MIRT1184833	hsa-miR-4314	CLIP-seq
MIRT2431600	hsa-miR-4489	CLIP-seq
MIRT1184839	hsa-miR-4646-5p	CLIP-seq
MIRT2431601	hsa-miR-4652-3p	CLIP-seq
MIRT2431602	hsa-miR-4668-5p	CLIP-seq
MIRT1556731	hsa-miR-4710	CLIP-seq
MIRT1556732	hsa-miR-4762-5p	CLIP-seq
MIRT1556733	hsa-miR-4773	CLIP-seq
MIRT2431603	hsa-miR-637	CLIP-seq
MIRT2438998	hsa-miR-1225-5p	CLIP-seq
MIRT2431594	hsa-miR-3153	CLIP-seq
MIRT2438999	hsa-miR-3202	CLIP-seq
MIRT2439000	hsa-miR-330-3p	CLIP-seq
MIRT2439001	hsa-miR-3670	CLIP-seq
MIRT1184831	hsa-miR-3929	CLIP-seq
MIRT1184834	hsa-miR-4419b	CLIP-seq
MIRT1184836	hsa-miR-4478	CLIP-seq
MIRT2439002	hsa-miR-4663	CLIP-seq
MIRT2431602	hsa-miR-4668-5p	CLIP-seq
MIRT2439003	hsa-miR-4700-3p	CLIP-seq
MIRT2439004	hsa-miR-4717-5p	CLIP-seq
MIRT2439005	hsa-miR-4728-5p	CLIP-seq
MIRT1184843	hsa-miR-4747-5p	CLIP-seq
MIRT2439006	hsa-miR-4753-5p	CLIP-seq
MIRT2439007	hsa-miR-4777-3p	CLIP-seq
MIRT1184845	hsa-miR-485-5p	CLIP-seq
MIRT2439008	hsa-miR-888	CLIP-seq
MIRT2439009	hsa-miR-891b	CLIP-seq
MIRT2455169	hsa-miR-186	CLIP-seq
MIRT2455170	hsa-miR-3117-3p	CLIP-seq
MIRT2455171	hsa-miR-3133	CLIP-seq
MIRT2455172	hsa-miR-3169	CLIP-seq
MIRT2455173	hsa-miR-369-3p	CLIP-seq
MIRT2455174	hsa-miR-374a	CLIP-seq
MIRT2455175	hsa-miR-374b	CLIP-seq
MIRT2455176	hsa-miR-4759	CLIP-seq
MIRT2580863	hsa-miR-105	CLIP-seq
MIRT2431592	hsa-miR-1197	CLIP-seq
MIRT2438998	hsa-miR-1225-5p	CLIP-seq
MIRT2580864	hsa-miR-1246	CLIP-seq
MIRT2580865	hsa-miR-1251	CLIP-seq
MIRT2580866	hsa-miR-1290	CLIP-seq
MIRT2580867	hsa-miR-1305	CLIP-seq
MIRT2580868	hsa-miR-1587	CLIP-seq
MIRT2580869	hsa-miR-188-5p	CLIP-seq
MIRT2580870	hsa-miR-190	CLIP-seq
MIRT2580871	hsa-miR-190b	CLIP-seq
MIRT2431593	hsa-miR-197	CLIP-seq
MIRT2580872	hsa-miR-203	CLIP-seq
MIRT2580873	hsa-miR-204	CLIP-seq
MIRT2053602	hsa-miR-2052	CLIP-seq
MIRT2580874	hsa-miR-211	CLIP-seq
MIRT2455170	hsa-miR-3117-3p	CLIP-seq
MIRT2580875	hsa-miR-3122	CLIP-seq
MIRT2580876	hsa-miR-3126-3p	CLIP-seq
MIRT2580877	hsa-miR-3129-3p	CLIP-seq
MIRT2580878	hsa-miR-3145-5p	CLIP-seq
MIRT2580879	hsa-miR-3152-5p	CLIP-seq
MIRT1184822	hsa-miR-3161	CLIP-seq
MIRT2580880	hsa-miR-3167	CLIP-seq
MIRT2455172	hsa-miR-3169	CLIP-seq
MIRT2580881	hsa-miR-3184	CLIP-seq
MIRT1184823	hsa-miR-3192	CLIP-seq
MIRT2580882	hsa-miR-3201	CLIP-seq
MIRT2438999	hsa-miR-3202	CLIP-seq
MIRT1184824	hsa-miR-326	CLIP-seq
MIRT2439000	hsa-miR-330-3p	CLIP-seq
MIRT1184825	hsa-miR-330-5p	CLIP-seq
MIRT2580883	hsa-miR-365	CLIP-seq
MIRT2439001	hsa-miR-3670	CLIP-seq
MIRT1184828	hsa-miR-3671	CLIP-seq
MIRT2580884	hsa-miR-3672	CLIP-seq
MIRT2580885	hsa-miR-3674	CLIP-seq
MIRT2580886	hsa-miR-3675-3p	CLIP-seq
MIRT2580887	hsa-miR-3685	CLIP-seq
MIRT2580888	hsa-miR-3688-5p	CLIP-seq
MIRT2580889	hsa-miR-3689a-3p	CLIP-seq
MIRT2580890	hsa-miR-3689c	CLIP-seq
MIRT2455174	hsa-miR-374a	CLIP-seq
MIRT2455175	hsa-miR-374b	CLIP-seq
MIRT2580891	hsa-miR-3913-5p	CLIP-seq
MIRT1184831	hsa-miR-3929	CLIP-seq
MIRT2580892	hsa-miR-3942-5p	CLIP-seq
MIRT2580893	hsa-miR-4260	CLIP-seq
MIRT2580894	hsa-miR-4263	CLIP-seq
MIRT2580895	hsa-miR-4272	CLIP-seq
MIRT2580896	hsa-miR-4282	CLIP-seq
MIRT2580897	hsa-miR-4283	CLIP-seq
MIRT2580898	hsa-miR-4307	CLIP-seq
MIRT1184833	hsa-miR-4314	CLIP-seq
MIRT1184834	hsa-miR-4419b	CLIP-seq
MIRT2580899	hsa-miR-4433	CLIP-seq
MIRT2580900	hsa-miR-4464	CLIP-seq
MIRT1184836	hsa-miR-4478	CLIP-seq
MIRT2431600	hsa-miR-4489	CLIP-seq
MIRT2580901	hsa-miR-4503	CLIP-seq
MIRT2580902	hsa-miR-4520a-3p	CLIP-seq
MIRT2580903	hsa-miR-4520b-3p	CLIP-seq
MIRT1184837	hsa-miR-4522	CLIP-seq
MIRT2580904	hsa-miR-4528	CLIP-seq
MIRT2580905	hsa-miR-4539	CLIP-seq
MIRT2580906	hsa-miR-4641	CLIP-seq
MIRT1184839	hsa-miR-4646-5p	CLIP-seq
MIRT2431601	hsa-miR-4652-3p	CLIP-seq
MIRT2439002	hsa-miR-4663	CLIP-seq
MIRT2580907	hsa-miR-4674	CLIP-seq
MIRT2439003	hsa-miR-4700-3p	CLIP-seq
MIRT2580908	hsa-miR-4703-5p	CLIP-seq
MIRT2439004	hsa-miR-4717-5p	CLIP-seq
MIRT2580909	hsa-miR-4728-3p	CLIP-seq
MIRT2439005	hsa-miR-4728-5p	CLIP-seq
MIRT2580910	hsa-miR-4735-5p	CLIP-seq
MIRT1184843	hsa-miR-4747-5p	CLIP-seq
MIRT2580911	hsa-miR-4748	CLIP-seq
MIRT2439006	hsa-miR-4753-5p	CLIP-seq
MIRT2455176	hsa-miR-4759	CLIP-seq
MIRT2580912	hsa-miR-4774-3p	CLIP-seq
MIRT2439007	hsa-miR-4777-3p	CLIP-seq
MIRT2580913	hsa-miR-4791	CLIP-seq
MIRT2580914	hsa-miR-4799-5p	CLIP-seq
MIRT2580915	hsa-miR-4802-3p	CLIP-seq
MIRT1184845	hsa-miR-485-5p	CLIP-seq
MIRT2580916	hsa-miR-489	CLIP-seq
MIRT2580917	hsa-miR-495	CLIP-seq
MIRT2580918	hsa-miR-503	CLIP-seq
MIRT2580919	hsa-miR-513a-3p	CLIP-seq
MIRT2580920	hsa-miR-513c	CLIP-seq
MIRT2580921	hsa-miR-514b-5p	CLIP-seq
MIRT2580922	hsa-miR-576-5p	CLIP-seq
MIRT1551756	hsa-miR-581	CLIP-seq
MIRT2580923	hsa-miR-635	CLIP-seq
MIRT2431603	hsa-miR-637	CLIP-seq
MIRT2580924	hsa-miR-651	CLIP-seq
MIRT2580925	hsa-miR-656	CLIP-seq
MIRT2580926	hsa-miR-7	CLIP-seq
MIRT1184848	hsa-miR-767-3p	CLIP-seq
MIRT2580927	hsa-miR-876-5p	CLIP-seq
MIRT2439008	hsa-miR-888	CLIP-seq
MIRT2439009	hsa-miR-891b	CLIP-seq
MIRT2580928	hsa-miR-944	CLIP-seq
MIRT2580863	hsa-miR-105	CLIP-seq
MIRT2431592	hsa-miR-1197	CLIP-seq
MIRT2438998	hsa-miR-1225-5p	CLIP-seq
MIRT2580864	hsa-miR-1246	CLIP-seq
MIRT2580865	hsa-miR-1251	CLIP-seq
MIRT2580866	hsa-miR-1290	CLIP-seq
MIRT2580867	hsa-miR-1305	CLIP-seq
MIRT2580868	hsa-miR-1587	CLIP-seq
MIRT2580869	hsa-miR-188-5p	CLIP-seq
MIRT2580870	hsa-miR-190	CLIP-seq
MIRT2580871	hsa-miR-190b	CLIP-seq
MIRT2431593	hsa-miR-197	CLIP-seq
MIRT2580872	hsa-miR-203	CLIP-seq
MIRT2580873	hsa-miR-204	CLIP-seq
MIRT2053602	hsa-miR-2052	CLIP-seq
MIRT2580874	hsa-miR-211	CLIP-seq
MIRT2455170	hsa-miR-3117-3p	CLIP-seq
MIRT2580875	hsa-miR-3122	CLIP-seq
MIRT2580876	hsa-miR-3126-3p	CLIP-seq
MIRT2580877	hsa-miR-3129-3p	CLIP-seq
MIRT2580878	hsa-miR-3145-5p	CLIP-seq
MIRT2580879	hsa-miR-3152-5p	CLIP-seq
MIRT2431594	hsa-miR-3153	CLIP-seq
MIRT1184822	hsa-miR-3161	CLIP-seq
MIRT2580880	hsa-miR-3167	CLIP-seq
MIRT2455172	hsa-miR-3169	CLIP-seq
MIRT2580881	hsa-miR-3184	CLIP-seq
MIRT1184823	hsa-miR-3192	CLIP-seq
MIRT2580882	hsa-miR-3201	CLIP-seq
MIRT2438999	hsa-miR-3202	CLIP-seq
MIRT1184824	hsa-miR-326	CLIP-seq
MIRT2439000	hsa-miR-330-3p	CLIP-seq
MIRT1184825	hsa-miR-330-5p	CLIP-seq
MIRT2580883	hsa-miR-365	CLIP-seq
MIRT2439001	hsa-miR-3670	CLIP-seq
MIRT1184828	hsa-miR-3671	CLIP-seq
MIRT2580884	hsa-miR-3672	CLIP-seq
MIRT2580885	hsa-miR-3674	CLIP-seq
MIRT2580886	hsa-miR-3675-3p	CLIP-seq
MIRT2580887	hsa-miR-3685	CLIP-seq
MIRT2580888	hsa-miR-3688-5p	CLIP-seq
MIRT2580889	hsa-miR-3689a-3p	CLIP-seq
MIRT2580890	hsa-miR-3689c	CLIP-seq
MIRT2455174	hsa-miR-374a	CLIP-seq
MIRT2455175	hsa-miR-374b	CLIP-seq
MIRT2580891	hsa-miR-3913-5p	CLIP-seq
MIRT1184831	hsa-miR-3929	CLIP-seq
MIRT2580892	hsa-miR-3942-5p	CLIP-seq
MIRT2580893	hsa-miR-4260	CLIP-seq
MIRT2580894	hsa-miR-4263	CLIP-seq
MIRT2580895	hsa-miR-4272	CLIP-seq
MIRT2580896	hsa-miR-4282	CLIP-seq
MIRT2580897	hsa-miR-4283	CLIP-seq
MIRT2580898	hsa-miR-4307	CLIP-seq
MIRT1184833	hsa-miR-4314	CLIP-seq
MIRT1184834	hsa-miR-4419b	CLIP-seq
MIRT2580899	hsa-miR-4433	CLIP-seq
MIRT2580900	hsa-miR-4464	CLIP-seq
MIRT1184836	hsa-miR-4478	CLIP-seq
MIRT2431600	hsa-miR-4489	CLIP-seq
MIRT2580901	hsa-miR-4503	CLIP-seq
MIRT2580902	hsa-miR-4520a-3p	CLIP-seq
MIRT2580903	hsa-miR-4520b-3p	CLIP-seq
MIRT1184837	hsa-miR-4522	CLIP-seq
MIRT2580904	hsa-miR-4528	CLIP-seq
MIRT2580905	hsa-miR-4539	CLIP-seq
MIRT2580906	hsa-miR-4641	CLIP-seq
MIRT1184839	hsa-miR-4646-5p	CLIP-seq
MIRT2431601	hsa-miR-4652-3p	CLIP-seq
MIRT2439002	hsa-miR-4663	CLIP-seq
MIRT2431602	hsa-miR-4668-5p	CLIP-seq
MIRT2580907	hsa-miR-4674	CLIP-seq
MIRT2439003	hsa-miR-4700-3p	CLIP-seq
MIRT2580908	hsa-miR-4703-5p	CLIP-seq
MIRT2439004	hsa-miR-4717-5p	CLIP-seq
MIRT2580909	hsa-miR-4728-3p	CLIP-seq
MIRT2439005	hsa-miR-4728-5p	CLIP-seq
MIRT2580910	hsa-miR-4735-5p	CLIP-seq
MIRT1184843	hsa-miR-4747-5p	CLIP-seq
MIRT2580911	hsa-miR-4748	CLIP-seq
MIRT2439006	hsa-miR-4753-5p	CLIP-seq
MIRT2455176	hsa-miR-4759	CLIP-seq
MIRT2580912	hsa-miR-4774-3p	CLIP-seq
MIRT2439007	hsa-miR-4777-3p	CLIP-seq
MIRT2580913	hsa-miR-4791	CLIP-seq
MIRT2580914	hsa-miR-4799-5p	CLIP-seq
MIRT2580915	hsa-miR-4802-3p	CLIP-seq
MIRT1184845	hsa-miR-485-5p	CLIP-seq
MIRT2580916	hsa-miR-489	CLIP-seq
MIRT2580917	hsa-miR-495	CLIP-seq
MIRT2580918	hsa-miR-503	CLIP-seq
MIRT2580919	hsa-miR-513a-3p	CLIP-seq
MIRT2580920	hsa-miR-513c	CLIP-seq
MIRT2580921	hsa-miR-514b-5p	CLIP-seq
MIRT2580922	hsa-miR-576-5p	CLIP-seq
MIRT1551756	hsa-miR-581	CLIP-seq
MIRT2580923	hsa-miR-635	CLIP-seq
MIRT2431603	hsa-miR-637	CLIP-seq
MIRT2580924	hsa-miR-651	CLIP-seq
MIRT2580925	hsa-miR-656	CLIP-seq
MIRT2580926	hsa-miR-7	CLIP-seq
MIRT1184848	hsa-miR-767-3p	CLIP-seq
MIRT2580927	hsa-miR-876-5p	CLIP-seq
MIRT2439008	hsa-miR-888	CLIP-seq
MIRT2439009	hsa-miR-891b	CLIP-seq
MIRT2580928	hsa-miR-944	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	ISS
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 25037231, 27068509, 27559042, 28675934
GO:0005509	Function	Calcium ion binding	IEA
GO:0005518	Function	Collagen binding	IDA	22952693
GO:0005518	Function	Collagen binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IDA	22952693
GO:0005604	Component	Basement membrane	IEA
GO:0005604	Component	Basement membrane	NAS	1678389
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	23658023, 25037231, 27068509, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0032836	Process	Glomerular basement membrane development	IEA
GO:0043236	Function	Laminin binding	IDA	22952693
GO:0043236	Function	Laminin binding	IEA
GO:0043237	Function	Laminin-1 binding	IEA
GO:0043394	Function	Proteoglycan binding	IPI	22952693
GO:0045785	Process	Positive regulation of cell adhesion	NAS	3794389
GO:0050840	Function	Extracellular matrix binding	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	NAS	26555376
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071711	Process	Basement membrane organization	IEA
GO:0071711	Process	Basement membrane organization	TAS	22952693
GO:0071944	Component	Cell periphery	IEA
GO:0098637	Component	Protein complex involved in cell-matrix adhesion	NAS	3109910
GO:0110011	Process	Regulation of basement membrane organization	NAS	2119632
GO:2001046	Process	Positive regulation of integrin-mediated signaling pathway	NAS	23948589

MIM	HGNC	e!Ensembl
131390	7821	ENSG00000116962

P14543

Protein name

Nidogen-1 (NID-1) (Entactin)

Protein function

Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix interactions.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06119	NIDO	176 → 267	Nidogen-like	Family
PF07474	G2F	429 → 622	G2F domain	Domain
PF07645	EGF_CA	710 → 750	Calcium-binding EGF domain	Domain
PF12662	cEGF	784 → 805	Complement Clr-like EGF-like	Domain
PF12947	EGF_3	806 → 839	EGF domain	Domain
PF00086	Thyroglobulin_1	849 → 919	Thyroglobulin type-1 repeat	Domain
PF00058	Ldl_recept_b	990 → 1030	Low-density lipoprotein receptor repeat class B	Repeat
PF00058	Ldl_recept_b	1033 → 1072	Low-density lipoprotein receptor repeat class B	Repeat
PF00058	Ldl_recept_b	1076 → 1118	Low-density lipoprotein receptor repeat class B	Repeat
PF14670	FXa_inhibition	1212 → 1242		Domain

Sequence

MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELS
GALRFYDRSDIDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFA
NDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLAT
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
HQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETV
GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGI
DEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGAS
PSRIYTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYNQEEKILRYALSNSIGPV
REGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
CGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRAQCIYT
GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDL
GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYW
TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQ
PSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITT
ALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK

Sequence length

1247

Interactions

View interactions

	KEGG		Reactome
	Cytoskeleton in muscle cells		Degradation of the extracellular matrix Laminin interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Focal epilepsy	Likely pathogenic	rs730882225	RCV000162140	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hemiparesis	Likely pathogenic	rs730882225	RCV000162140	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hydrocephalus	Likely pathogenic	rs730882225	RCV000162140	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CEREBELLAR DYSFUNCTION WITH VARIABLE COGNITIVE AND BEHAVIORAL ABNORMALITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSIES, PARTIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36768220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arachnoid Cysts	Arachnoid cyst	BEFREE	30773799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23681936, 28827399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28827399, 33500458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30947697	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33890711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	30276677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28416770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17328794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17328794, 30831320, 33890711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cerebral hernia	Congenital Cerebral Hernia	BEFREE	23674478, 30773799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cerebral hernia	Congenital Cerebral Hernia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	23674478, 30773799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	ORPHANET_DG	30773799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12873452, 24255036, 25446319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	11159210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	11159210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	23674478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25924802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	17328794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33735110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	25857602, 7857884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	25857602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ileus	Ileus	BEFREE	7857884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	40243655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	40243655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28827399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25924802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17328794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28416770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26018085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17328794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17328794, 28282545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17328794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	21478494, 27993549		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21478494, 27993549, 28827399		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	21478494, 28827399	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	23681936, 25844669, 25924802, 26018085, 28282545, 30276677, 31315917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	21478494, 27993549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	GWASDB_DG	21478494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	GWASCAT_DG	21478494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28282545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18438862	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28416770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28416770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Platybasia	Platybasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26018085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	7857885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30276677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31315917	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	31315917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17328794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28402931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NID1 (nidogen 1)