Gene Gene information from NCBI Gene database.
Entrez ID 4804
Gene name Nerve growth factor receptor
Gene symbol NGFR
Synonyms (NCBI Gene)
CD271Gp80-LNGFRTNFRSF16p75(NTR)p75NTR
Chromosome 17
Chromosome location 17q21.33
Summary Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic
miRNA miRNA information provided by mirtarbase database.
104
miRTarBase ID miRNA Experiments Reference
MIRT016762 hsa-miR-335-5p Microarray 18185580
MIRT472231 hsa-miR-6507-3p PAR-CLIP 23592263
MIRT472230 hsa-miR-1321 PAR-CLIP 23592263
MIRT472229 hsa-miR-4739 PAR-CLIP 23592263
MIRT472228 hsa-miR-4756-5p PAR-CLIP 23592263
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
MYCN Repression 21123453
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
86
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding TAS 26871627
GO:0001678 Process Intracellular glucose homeostasis IEA
GO:0001678 Process Intracellular glucose homeostasis ISS
GO:0001942 Process Hair follicle development IEA
GO:0004888 Function Transmembrane signaling receptor activity TAS 1846035
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
162010 7809 ENSG00000064300
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P08138
Protein name Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (Low-affinity nerve growth factor receptor p75NGFR) (Low-affinity nerve growth factor
Protein function Low affinity receptor which can bind to NGF, BDNF, NTF3, and NTF4. Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF, BDNF and NTF3 with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:24
PDB 2N80 , 2N83 , 2N97 , 3EWV , 5ZGG , 7CSQ , 8X8T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 109 146 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 149 188 TNFR/NGFR cysteine-rich region Domain
PF18422 TNFR_16_TM 246 283 Tumor necrosis factor receptor member 16 trans-membrane domain Domain
PF00531 Death 344 421 Death domain Domain
Sequence
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVC
EECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAEC
EEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
S
TATSPV
Sequence length 427
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Virion - Ebolavirus, Lyssavirus and Morbillivirus
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis - multiple species
Neurotrophin signaling pathway
Transcriptional misregulation in cancer
  Axonal growth inhibition (RHOA activation)
Regulated proteolysis of p75NTR
NFG and proNGF binds to p75NTR
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
12
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMERS DISEASE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute leukemia Leukemia BEFREE 16173964, 3006050
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 16173964
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 3006050
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 31019292
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 16077909, 16826429, 17550129, 2172988, 26497209, 29930101, 8437665
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 16539663, 22236693, 26738357, 28558704, 31745181, 36074475, 36189598 Associate
★☆☆☆☆
Found in Text Mining only
Ameloblastoma Ameloblastoma Pubtator 27737362 Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 8221061
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 28506859
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis Pubtator 35309353 Associate
★☆☆☆☆
Found in Text Mining only