NGF (nerve growth factor)

Gene

• Entrez ID: 4803
• Gene name: Nerve growth factor
• Gene symbol: NGF
• Synonyms (NCBI Gene): Beta-NGF, HSAN5, NGFB
• Chromosome: 1
• Chromosome location: 1p13.2
• Summary: This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the d

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT733688	hsa-let-7a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	31925656

Transcription factors

Transcription factor	Regulation	Reference
FOS	Unknown	2111020
ING4	Repression	22078444
JUN	Unknown	2111020

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005163	Function	Nerve growth factor receptor binding	IBA
GO:0005163	Function	Nerve growth factor receptor binding	IPI	14985763
GO:0005515	Function	Protein binding	IPI	10490030, 14985763, 15131306, 15710408, 18596692, 19122660, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005768	Component	Endosome	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007422	Process	Peripheral nervous system development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008021	Component	Synaptic vesicle	IBA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IDA	20164177
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10362258
GO:0008289	Function	Lipid binding	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	14985763
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IGI	11927634
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	16153003
GO:0010628	Process	Positive regulation of gene expression	ISS	10362258
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014042	Process	Positive regulation of neuron maturation	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0021675	Process	Nerve development	IBA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0030424	Component	Axon	IBA
GO:0030425	Component	Dendrite	IBA
GO:0031175	Process	Neuron projection development	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031904	Component	Endosome lumen	IEA
GO:0038177	Function	Death receptor agonist activity	IGI	11927634
GO:0038180	Process	Nerve growth factor signaling pathway	IBA
GO:0038180	Process	Nerve growth factor signaling pathway	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	TAS	10362258
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IEA
GO:0046579	Process	Positive regulation of Ras protein signal transduction	ISS
GO:0046928	Process	Regulation of neurotransmitter secretion	IEA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IEA
GO:0048672	Process	Positive regulation of collateral sprouting	IEA
GO:0048675	Process	Axon extension	IEA
GO:0048812	Process	Neuron projection morphogenesis	IBA
GO:0048812	Process	Neuron projection morphogenesis	IDA	17724343
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	IGI	11927634
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA

Other IDs

• MIM: 162030
• HGNC: 7808
• e!Ensembl: ENSG00000134259

Protein

• UniProt ID: P01138
• Protein name: Beta-nerve growth factor (Beta-NGF)
• Protein function: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems (PubMed:14976160, PubMed:20978020). Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades
• PDB: 1SG1, 1WWW, 2IFG, 4EDW, 4EDX, 4ZBN, 5JZ7, 6YW8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00243	NGF	128 → 238	Nerve growth factor family	Domain

• Sequence:

  MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
  ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
  RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
  DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
  A

• Sequence length: 241

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels

Reactome:

NGF processing
Frs2-mediated activation
ARMS-mediated activation
Retrograde neurotrophin signalling
TRKA activation by NGF
PI3K/AKT activation
NFG and proNGF binds to p75NTR
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Congenital sensory neuropathy with selective loss of small myelinated fibers	Pathogenic; Likely pathogenic	rs753382007, rs11466112, rs2101018240	RCV002606031 RCV000015089 RCV000022672	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Peripheral neuropathy	Pathogenic	rs2101018240	RCV004798744	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHRONIC SKIN ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL PAIN INSENSITIVITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ULCER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TONIC-CLONIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AND AUTONOMIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AND AUTONOMIC NEUROPATHY	—	ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AND AUTONOMIC NEUROPATHY TYPE 5	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AUTONOMIC NEUROPATHY, TYPE 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AUTONOMIC NEUROPATHY, TYPE 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AUTONOMIC NEUROPATHY, TYPE 5	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL CYSTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY, HEREDITARY SENSORY AND AUTONOMIC, TYPE V	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NGF-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORY NEUROPATHY, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN ULCER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONIC-CLONIC EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER, OVERACTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28270361		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29802376		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	26439032		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10628752		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	16546643		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11567048		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	11152283, 11288140, 11877300, 1702431, 17624931, 1849459, 19717419, 19766605, 2153893, 24469107, 26786970, 2864475, 29222785, 29427534, 29654109, 30036464, 30656694, 30885631, 30909654, 31030559, 31091528, 31402210, 31571871, 31606330, 8939459, 8963445		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	19717419		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	2172988, 8437665, 8987776		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30871541		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	31792359		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	17667132, 22626591		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21397006, 22330829, 23095849, 26302439, 27389402, 28498887, 28888073, 29582053, 32126838	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	9453564	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease familial type 3	Alzheimer disease	Pubtator	22330829	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	22330829		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	CTD_human_DG	16405025, 19694610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amnesia	Amnesia	BEFREE	7722631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	22261363, 24813062, 24846616, 25026432, 28336494, 29499358, 29714500		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	11567048		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15056289, 28537420, 28694091, 30980198, 8221061		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29702606, 32174778	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30578789		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31736231		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	28574013	Associate	★☆☆☆☆ Found in Text Mining only
Anhidrosis	Anhidrosis	BEFREE	10567924, 11159935, 15468048, 24494678, 8696348		★☆☆☆☆ Found in Text Mining only
Anhidrosis	Anhidrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29975347		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	18763222, 22832952, 23566423, 27862119, 28757245		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	22832952, 28413930	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	18763222, 22832952, 23566423, 27862119, 28757245		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	23772677	Associate	★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	26577823	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19490633, 31621576, 8217218		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	20581375, 21792838, 26577823, 35309353	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21792838	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	9534881	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19490633, 21792838	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20581375	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	22359072, 30910989		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12212982, 12900521, 23195334, 33787326, 40696647	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12900521		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	20934630, 22468730, 23195334, 28861085, 29568869, 29611766, 29757584, 30359762, 30836174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	15138791, 16569497, 17635673, 18758067, 29391888, 30959808, 7696584		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17635673	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	23608378	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	26446633, 32781864	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28749900, 31101572, 31503549		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	17192954, 18763222, 27561780, 28751869, 31170860		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22105621	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	22105621, 28751869, 30320048		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15763921, 25876154	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24244623	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	8217218		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	19694610		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	19694610		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	19694610		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	9658722		★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	30981636, 31432572		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	12918708		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28237042, 29379359, 29630981, 30519263		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	30607794		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25730879, 38484669	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	28803094, 31170316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder neck obstruction	Bladder neck obstruction	BEFREE	29630981		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28326938		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	35300334	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	30785087		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	27898323		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	23608378	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	17881264, 39359202	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	23608378	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	22410557	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	24519935, 28239803		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11389056, 14997042, 16180717, 16242838, 18199526, 18716795, 19711341, 21350004, 22128158, 22217202, 24180625, 28396216, 28574013, 28854595		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10606728, 10681513, 11359788, 16984733, 18716795, 21241485, 24180625, 33026185, 9642218	Associate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	24244623		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	22871964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	27898323		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27302927	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28679437		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	9406845	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	20690417	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33649819	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10340952		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33081171	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36319832	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29802376	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16168216, 16935322, 21236475, 22411587, 22773372, 25296882, 27835587, 28116735, 28245631, 28260038, 28928825, 29774060, 31817839		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22187379, 23437390		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10764418, 30030957		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	26577823, 35300334	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	30663865		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31751158		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27676696, 29423079, 30662601, 30688263		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29499660	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11483654, 25921200, 29149884, 29499660, 29720604, 30393197, 30458203, 30649102, 31736231		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	23437390		★☆☆☆☆ Found in Text Mining only
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2B (disorder)	Charcot-Marie-Tooth Disease	BEFREE	23616551		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	2172988, 8437665, 8987776		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23637956		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24744599	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29328070		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	17700442		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	9694155		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	17905097, 23727186, 28056917, 29521057		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	CTD_human_DG	24244623		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	CTD_human_DG	24244623		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	9658722		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30076938		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	17611164, 26668319, 27454463, 35300334	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Prostatitis with Chronic Pelvic Pain Syndrome	Prostatitis With Chronic Pelvic Pain Syndrome	BEFREE	31204623		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	25816145, 30336268		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22330829, 35516456, 37175781	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28351757, 28740732, 30481505		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23095849	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	28888073	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28587873, 28937245		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10764711	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38149258	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23696568		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21966426, 2775292		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32235004, 9290260	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28482594, 29532893		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	24971614	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Pain Insensitivity	Congenital Pain Insensitivity	ORPHANET_DG	14976160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Pain Insensitivity	Congenital Pain Insensitivity	BEFREE	19593630, 22882139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	10764418		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	CTD_human_DG	24244623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Ulcer	Corneal ulcer	Pubtator	24244623, 30599086	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Ulcer	Corneal Ulcer	BEFREE	30599086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31383364		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	11935372		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21679057		★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	24112788		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	24094526	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	17881264	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	19958603		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10764711		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	10764711, 38149258	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptogenic Tonic-Clonic Epilepsy	Cryptogenic Tonic-Clonic Epilepsy	CTD_human_DG	16023256		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10561084	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	16889433, 18299998, 28446032, 29057994, 29800607, 31204623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystitis	Cystitis	CTD_human_DG	16889433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystitis Interstitial	Interstitial cystitis	Pubtator	24146927	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	24244623		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	24244623		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12468822, 19490633, 21871595, 25529198, 27635406, 27672741, 27936977, 28253191, 28441116, 28677145, 28814877, 28844566, 28955292, 28967370, 29118440, 29163027, 30562625, 30624091, 30663865, 30842121, 30862648, 30910989, 31145219, 31312184, 31495059, 31621576		★☆☆☆☆ Found in Text Mining only
Delusional disorder	Delusional Disorder	BEFREE	29081418		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	25737042, 28427492, 29582053		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	26738357	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	10618694		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	14699963, 15940299, 29149884, 29894705, 30235967, 30932945, 31319037, 31807545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23020178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	35069013	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	31889537	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	21893340	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15748947, 19038326, 24628071, 26385242		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18922682, 18922683		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	36012289	Stimulate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	24971614	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	BEFREE	30320048		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12588889, 15164170, 18285558, 18329889, 22187379, 28535564, 29091313, 29693500, 29805536, 30030957, 31016359, 31073629, 31385776		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12588889, 15164170, 18285558, 18329889, 22187379, 28535564, 29091313, 29157806, 29609091, 29693500, 29805536, 30030957, 31016359, 31073629, 31385776		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23998130	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26579581	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31016359		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28179636, 28437012, 28740732, 29724155, 30145601		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	18329889		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	22187379		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	26579581	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	10229303, 28437012, 29966615, 30632491, 8926497		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27964967, 29421993		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22076137		★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Distal myopathy	Pubtator	36228098	Inhibit	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	16815330, 26658127, 29342922		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	37916377	Associate	★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	6330750		★☆☆☆☆ Found in Text Mining only
Dysautonomia Familial	Dysautonomia	Pubtator	3392215, 6244581	Associate	★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	3392215, 6330750		★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	6244581	Associate	★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	18203754		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	11028855	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15748947, 19038326, 24628071, 26385242		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	26604067		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18061173	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18976764, 22717347, 23883529, 25865020, 32240297	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26604067	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28673205, 29108503, 29855537, 31204623		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	15138791		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	11124444, 28710024		★☆☆☆☆ Found in Text Mining only
Epilepsy, Tonic-Clonic, Familial	Epilepsy	CTD_human_DG	16023256		★☆☆☆☆ Found in Text Mining only
Epilepsy, Tonic-Clonic, Symptomatic	Epilepsy	CTD_human_DG	16023256		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	18398367		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16168216, 16935322, 21236475, 22411587, 22773372, 25296882, 28116735, 28245631, 28260038, 29774060, 31817839		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	28179636, 29285284, 29724155		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10769644		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10769644		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16832412	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	2550483, 27145455		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	2171417		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	1680304, 8939861		★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	19694610		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	844218		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	31732726		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	31178329		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	10561084		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19072833, 25816145, 30336268		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	28737124		★☆☆☆☆ Found in Text Mining only
Full thickness hole of macula lutea	Full Thickness Hole Of Macula Lutea	BEFREE	31208396		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	20353905	Stimulate	★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	8246962		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26337663	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	38098488	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	25336328		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	29459716	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	25418464	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28068360		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10728904, 21596795		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36675126, 37951450	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10728904, 21596795		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10360476, 18175076, 19950533, 2365067, 28381676, 30417351, 31625742		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34257579	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	24971614		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	19169037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	LHGDN	19169037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	24244623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	24244623	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30871541		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	10084541	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	10764418		★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	30233017		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28827818		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	BEFREE	15002051		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	15626778		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	30233017		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	BEFREE	19183217, 26232991, 26562335		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	22302274, 30384131, 32807182, 37248554, 37769650, 8696348, 9290260	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary sensory and autonomic neuropathy type 5	Hereditary Sensory And Autonomic Neuropathy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 2	Hereditary sensory and autonomic neuropathy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 5	Hereditary sensory and autonomic neuropathy	BEFREE	12210794, 15468048, 18420729, 19945432, 20978020, 23157347, 24494679, 29483280, 30296891, 30384131, 30391352, 30524266, 30612733, 30632491, 31685654		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 5	Hereditary sensory and autonomic neuropathy	GENOMICS_ENGLAND_DG	1317267, 14976160, 15131306, 19038341		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 5	Hereditary sensory and autonomic neuropathy	ORPHANET_DG	14976160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 5	Hereditary sensory and autonomic neuropathy	UNIPROT_DG	14976160, 20978020, 22302274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 5	Hereditary sensory and autonomic neuropathy	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 5	Hereditary sensory and autonomic neuropathy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Radicular Neuropathy	Hereditary sensory and autonomic neuropathy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	8176607		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28654704		★☆☆☆☆ Found in Text Mining only
HSAN Type IV	Hereditary insensitivity to pain with anhidrosis	BEFREE	10330344, 10567924, 10861667, 10982191, 11071380, 11159935, 11748840, 12102460, 12210794, 15114061, 15695606, 16138253, 19089473, 19201660, 20647579, 20977328, 22882139, 23157347, 24494678, 24494679, 25316729, 29407522		★☆☆☆☆ Found in Text Mining only
HSAN Type IV	Hereditary insensitivity to pain with anhidrosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	14999077, 28654704		★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	10084541	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperalgesia	Hyperalgesia	Pubtator	28447608	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	21386984, 35088883	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25946624, 31385776, 31774700		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28363184		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	26302439	Associate	★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	30131307		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	30131307		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21535870	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	29052293		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	21178826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	12722829, 15066159, 18986241, 19355851, 22113314, 22301435, 24112788, 28351757, 28606823, 28740732, 29114922, 29209220, 29582053, 29736736, 30092220, 30481505, 30524266, 30809111, 7722631		★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	30503720		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	10408807		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10764711, 29543647		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10764711	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	16889433, 17905097, 23727186, 28056917, 29521057, 31575913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interstitial Cystitis	Interstitial Cystitis	LHGDN	17905097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	18727839, 26668319, 33652921	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23792102, 24650225, 25062286		★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	BEFREE	28079757		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30027341		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29052293, 29543647, 30988299, 31204623, 31272268		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27919823, 29409115, 29499660, 30662601, 31073355		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	24585880		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	25383879		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	Pubtator	35408969	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	16275928, 24644548		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	16275928	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	8204884		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19169037, 26066770		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24244623	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	24244623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	31678286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lafora Disease	Lafora Disease	BEFREE	30092220		★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	17324588		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	22510739	Inhibit	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26616164, 29867937		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15731354	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19059881, 19668232		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19059881	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15731354	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15731354		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	19276553, 30092220		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	19276553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	15523689, 29476769		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15523689, 17854142		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15523689, 25816145, 30336268		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25816145	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25816145, 31996124	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24223945	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36741410	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12453472		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28112808		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16832412	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10880028		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17673289		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	8204884		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26021968, 27898323, 29898192, 31170316		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15084380		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	19717419		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11389056, 16180717, 16242838, 18199526, 18716795, 19711341, 21350004, 22128158, 22217202, 28396216, 28574013, 28854595		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10769644		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29459716, 30741921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10340952		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25296882, 27835587, 28928825		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10561305, 12120231, 12410565, 15554384, 15944784, 16704535, 17671718, 19120874, 19584258, 25946624, 27654574, 27792755, 28440296, 31792027		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10353759, 11027413, 12213679, 17143529, 18280641, 28237042, 31174415, 9687989		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12854135, 30039889		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10462038, 11027413, 11205897, 12410565, 12796393, 16935322, 17143529, 17635673, 18280641, 27264679, 27654574, 28073000, 28237042, 28245631, 28260038, 28557340, 28797868, 28903357, 29222786, 30030957, 30031169, 30368018, 31608227, 31812953		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23696568		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17638883, 18199526		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18199526, 19711341, 21350004, 29565967		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	31574363		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	23869086, 28112808		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23869086	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	29088753		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	844218		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	19943845	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	2172988, 8437665, 8987776		★☆☆☆☆ Found in Text Mining only
Megaesophagus	Megaesophagus	BEFREE	29550999		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18305571		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24226422, 35457078, 38195702, 8305739	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24489649, 26496938, 2775292, 29407470, 31071716, 8305739, 8471834		★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	29042964		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	14699963, 15940299, 29149884, 29894705, 30235967, 30932945, 31319037, 31807545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23020178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	20712016, 27898323		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29744662		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25162674	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25916157, 28637031		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29175861		★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	10408807		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	17611164, 28447608	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28447608		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	17908035, 22301435, 22330829, 25737042, 27802234, 30853882, 30983028		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	21294249		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	20561151	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18976764, 30503131	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	26604067	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	31758701		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17626627, 30779035, 31578352		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10618694, 28112808, 29174194, 31027862		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	12753507	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	19063739		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19063739	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36754216	Inhibit	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	24843230	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28161362		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	15763921	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	15763921	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	28090659		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28090659		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18427551		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20360245, 29253516, 29578125, 31175933		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31383364		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19958603		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32986378	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10561305, 10769644, 10880028, 11205897, 12410565, 14997042, 15138791, 15523689, 15944784, 16180717, 16832412, 1706306, 17143529, 18086126, 18175076, 18199526, 1964795, 21236475, 22217202, 23637956, 23999075, 24180625, 24706657, 26439032, 27145455, 27654574, 27694752, 2775292, 28557340, 2864475, 28878143, 29904026, 30031169, 30039889, 30158856, 30233017, 30607794, 31178329, 31812953, 7977648, 8441429, 8625212, 8987776, 9687989, 9766365, 9811468, 9816308		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	CTD_human_DG	16889433		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	CTD_human_DG	16889433		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11157019		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	14686749, 37769650	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	11520933, 27919823, 29320631, 29875237, 30443202		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	CTD_human_DG	15093677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	19943845		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	7728338		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10086274, 10200344, 10336437, 10462038, 10803465, 11205744, 12101231, 12438236, 14691455, 15314226, 15488758, 15992370, 16111675, 16556046, 17409494, 17873363, 19458627, 1963076, 1964795, 21123453, 2156211, 2167446, 21683221, 2172988, 23778138, 24469107, 24706657, 25026432, 2504935, 25921289, 28671636, 29242118, 29374092, 31605506, 7523588, 7669728, 8144393, 8246962, 8397102, 8433391, 8441429, 8481906, 8514446, 8656283, 8963445, 9049830, 9136990, 9523557, 9811468, 9822157		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1527053, 15992370, 17409494, 21990266, 23999075, 3146694, 34556815, 35887076, 39389992, 8441429, 9523557	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11161609, 24367504	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24244623	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10516713, 14699979, 21631402, 22666365, 26302439, 26801170, 27618740, 27813712, 27893605, 27964967, 27988302, 28031222, 28160859, 28282920, 28501999, 28537420, 28646880, 29253516, 30391352, 30700208, 30735167, 31291595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	24244623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	1964795, 2171417		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	11000524, 12213675, 31383364		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	9078372		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	2983544, 6774282, 9078372		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	Pubtator	2983544	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	2983544, 6774282, 9078372		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	BEFREE	9078372		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	29752515, 30219559		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	10229303, 11360269, 15927533, 20978020, 23157347, 31026504, 9753304		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20214505		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24971614	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31787367, 8593794		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	28208669		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20581375, 26577823, 26668319, 30562625, 33953899, 36769248	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	25054223, 25196344, 34209473	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Hip	Osteoarthritis	Pubtator	34589551, 36769248	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	23608378, 31077183, 31557169, 39313491	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23608378, 29100502, 31077183, 31557169		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteomyelitis	Osteomyelitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24067459	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23883529, 33081171	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25296882, 27835587, 28928825		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27835587	Associate	★☆☆☆☆ Found in Text Mining only
Pain Insensitivity Congenital	Congenital pain insensitivity	Pubtator	19183217, 37248554, 37769650	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10561305, 12120231, 12410565, 15554384, 15944784, 16704535, 17671718, 19120874, 19584258, 25946624, 27654574, 27792755, 28440296, 31792027		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	14613990, 29975347		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21386984, 27792755, 32294802, 33820868, 35088883, 35188730, 35449152	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28270361		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	10561084	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	10561084, 28270361		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	9172002		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19276553, 23695225, 23934644, 28321769, 29588162, 29955238		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	19276553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	35516456, 37673381	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	19694610		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	19694610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	19694610		★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	26569118	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29287688		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	15319252		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29867937, 30632491, 9572670, 9753304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29867937, 30235967, 9753304		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Petit mal status	Petit Mal Status	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	11152283, 11288140, 11877300, 1702431, 1849459, 19717419, 19766605, 2153893, 24469107, 26786970, 2864475, 29222785, 29427534, 29654109, 30656694, 30885631, 30909654, 31030559, 31091528, 31402210, 31571871, 31606330, 8939459, 8963445		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	16098468, 23785438	Associate	★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	24112788		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29084332		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	14997042		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	19264868, 20041792, 25211588, 29580253		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27908212, 33622336	Associate	★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	29521057, 31410520		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28364364, 29799860, 31704315		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	25737042, 28427492, 29582053		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	24112788		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	11818506, 8833656		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	29084332		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10353759, 11027413, 12213679, 16242838, 17143529, 18280641, 28237042, 31174415, 9687989		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10353759, 10440874		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18280641		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25285721	Associate	★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	31074030		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	21893340	Inhibit	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	22948508, 30809683	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	11028855, 9534881	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18349121		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	19942804	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22359072, 23278632, 30446190, 30893385		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	38174374	Inhibit	★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	19694610		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	26066770		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	36011952	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	27964967		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	27964967, 30680928, 30871541		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	27964967, 28013393, 28632034		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	19816090		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	30680928		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	39940677	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	8780893		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19490633, 8217218		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	17667132, 22626591, 31145195		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	19076929		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	30146165		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21059230	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	21059230	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21059230	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	27145455	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14699963, 27898323, 28070123, 29165654, 29366645, 29782958, 30172685, 30269004, 30782512, 31105606, 7786881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	30285260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	7786881	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwannomatosis	Schwannomatosis	Pubtator	26657314	Associate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	31348022		★☆☆☆☆ Found in Text Mining only
Sensory Neuropathy, Hereditary	Sensory Neuropathy, Hereditary	BEFREE	10567924, 16775373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensory Neuropathy, Hereditary	Sensory Neuropathy, Hereditary	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary syndrome	Pubtator	22948508	Stimulate	★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	19942804	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29080684		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	17667845	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	17667845, 28903938		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12213675		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	31741027		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	30785087		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	19490633		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	19490633	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16832412		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29802376		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16832412		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29904026, 35211756, 35925599	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29904026, 31838083		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	8635431, 8821376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12854135, 30039889		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12854135	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28679437	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	29499660	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	19490633, 30663865		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	19490633	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28557340		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	24112788		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	28722246		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	9626993		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	7565764		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
Tonic-Clonic Epilepsy	Tonic-Clonic Epilepsy	CTD_human_DG	16023256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31839752		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30503720		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10764711		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	26021968, 31170316		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary Bladder Diseases	BEFREE	27378135		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	36012289	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Overactive	Overactive bladder	Pubtator	28089729	Inhibit	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	LHGDN	19054925		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	19054925	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37445902	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	31732726		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	30702560		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	26848019	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	29117739		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	31758701		★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	11028855	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30721702, 31175933		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	18815271		★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	30503720		★☆☆☆☆ Found in Text Mining only