Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4801
Gene name	Nuclear transcription factor Y subunit beta
Gene symbol	NFYB
Synonyms (NCBI Gene)	CBF-ACBF-BHAP3NF-YB
Chromosome	12
Chromosome location	12q23.3
Summary	The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a ti

279

Show/Hide all (279)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005607	hsa-miR-485-3p	Luciferase reporter assayqRT-PCRWestern blot	21252292
MIRT005607	hsa-miR-485-3p	Luciferase reporter assayqRT-PCRWestern blot	21252292
MIRT025209	hsa-miR-181a-5p	Sequencing	20371350
MIRT047937	hsa-miR-30c-5p	CLASH	23622248
MIRT555999	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT555998	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT555997	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT555996	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT555995	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT555994	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT555993	hsa-miR-137	PAR-CLIP	21572407
MIRT555992	hsa-miR-28-3p	PAR-CLIP	21572407
MIRT555991	hsa-miR-4699-3p	PAR-CLIP	21572407
MIRT555990	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT555989	hsa-miR-143-3p	PAR-CLIP	21572407
MIRT555988	hsa-miR-4770	PAR-CLIP	21572407
MIRT555987	hsa-miR-6088	PAR-CLIP	21572407
MIRT555986	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT555985	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT555984	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT555999	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT555998	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT555997	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT555996	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT555995	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT555994	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT555993	hsa-miR-137	PAR-CLIP	21572407
MIRT555992	hsa-miR-28-3p	PAR-CLIP	21572407
MIRT555991	hsa-miR-4699-3p	PAR-CLIP	21572407
MIRT555990	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT555989	hsa-miR-143-3p	PAR-CLIP	21572407
MIRT555988	hsa-miR-4770	PAR-CLIP	21572407
MIRT555987	hsa-miR-6088	PAR-CLIP	21572407
MIRT555986	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT555985	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT555984	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT1183933	hsa-miR-122	CLIP-seq
MIRT1183934	hsa-miR-1224-5p	CLIP-seq
MIRT1183935	hsa-miR-1225-3p	CLIP-seq
MIRT1183936	hsa-miR-1226	CLIP-seq
MIRT1183937	hsa-miR-1233	CLIP-seq
MIRT1183938	hsa-miR-1237	CLIP-seq
MIRT1183939	hsa-miR-1248	CLIP-seq
MIRT1183940	hsa-miR-1298	CLIP-seq
MIRT1183941	hsa-miR-143	CLIP-seq
MIRT1183942	hsa-miR-181a	CLIP-seq
MIRT1183943	hsa-miR-181b	CLIP-seq
MIRT1183944	hsa-miR-181c	CLIP-seq
MIRT1183945	hsa-miR-181d	CLIP-seq
MIRT1183946	hsa-miR-197	CLIP-seq
MIRT1183947	hsa-miR-221	CLIP-seq
MIRT1183948	hsa-miR-222	CLIP-seq
MIRT1183949	hsa-miR-2964a-5p	CLIP-seq
MIRT1183950	hsa-miR-300	CLIP-seq
MIRT1183951	hsa-miR-3124-3p	CLIP-seq
MIRT1183952	hsa-miR-3135b	CLIP-seq
MIRT1183953	hsa-miR-3150a-5p	CLIP-seq
MIRT1183954	hsa-miR-3150b-3p	CLIP-seq
MIRT1183955	hsa-miR-3150b-5p	CLIP-seq
MIRT1183956	hsa-miR-3163	CLIP-seq
MIRT1183957	hsa-miR-323-3p	CLIP-seq
MIRT1183958	hsa-miR-338-5p	CLIP-seq
MIRT1183959	hsa-miR-340	CLIP-seq
MIRT1183960	hsa-miR-3646	CLIP-seq
MIRT1183961	hsa-miR-3652	CLIP-seq
MIRT1183962	hsa-miR-381	CLIP-seq
MIRT1183963	hsa-miR-4262	CLIP-seq
MIRT1183964	hsa-miR-4275	CLIP-seq
MIRT1183965	hsa-miR-431	CLIP-seq
MIRT1183966	hsa-miR-433	CLIP-seq
MIRT1183967	hsa-miR-4430	CLIP-seq
MIRT1183968	hsa-miR-4433	CLIP-seq
MIRT1183969	hsa-miR-4477a	CLIP-seq
MIRT1183970	hsa-miR-4502	CLIP-seq
MIRT1183971	hsa-miR-4517	CLIP-seq
MIRT1183972	hsa-miR-4645-3p	CLIP-seq
MIRT1183973	hsa-miR-4666-3p	CLIP-seq
MIRT1183974	hsa-miR-4668-3p	CLIP-seq
MIRT1183975	hsa-miR-4684-5p	CLIP-seq
MIRT1183976	hsa-miR-4688	CLIP-seq
MIRT1183977	hsa-miR-4700-3p	CLIP-seq
MIRT1183978	hsa-miR-4711-5p	CLIP-seq
MIRT1183979	hsa-miR-4715-5p	CLIP-seq
MIRT1183980	hsa-miR-4733-3p	CLIP-seq
MIRT1183981	hsa-miR-4751	CLIP-seq
MIRT1183982	hsa-miR-4762-3p	CLIP-seq
MIRT1183983	hsa-miR-4784	CLIP-seq
MIRT1183984	hsa-miR-4797-5p	CLIP-seq
MIRT1183985	hsa-miR-488	CLIP-seq
MIRT1183986	hsa-miR-501-3p	CLIP-seq
MIRT1183987	hsa-miR-502-3p	CLIP-seq
MIRT1183988	hsa-miR-5096	CLIP-seq
MIRT1183989	hsa-miR-513c	CLIP-seq
MIRT1183990	hsa-miR-514b-5p	CLIP-seq
MIRT1183991	hsa-miR-520d-5p	CLIP-seq
MIRT1183992	hsa-miR-524-5p	CLIP-seq
MIRT1183993	hsa-miR-548c-3p	CLIP-seq
MIRT1183994	hsa-miR-556-5p	CLIP-seq
MIRT1183995	hsa-miR-570	CLIP-seq
MIRT1183996	hsa-miR-592	CLIP-seq
MIRT1183997	hsa-miR-593	CLIP-seq
MIRT1183998	hsa-miR-597	CLIP-seq
MIRT1183999	hsa-miR-603	CLIP-seq
MIRT1184000	hsa-miR-642b	CLIP-seq
MIRT1184001	hsa-miR-873	CLIP-seq
MIRT1184002	hsa-miR-889	CLIP-seq
MIRT1184003	hsa-miR-924	CLIP-seq
MIRT1184004	hsa-miR-935	CLIP-seq
MIRT1183947	hsa-miR-221	CLIP-seq
MIRT1183948	hsa-miR-222	CLIP-seq
MIRT1183950	hsa-miR-300	CLIP-seq
MIRT1183957	hsa-miR-323-3p	CLIP-seq
MIRT1183962	hsa-miR-381	CLIP-seq
MIRT1183964	hsa-miR-4275	CLIP-seq
MIRT1183973	hsa-miR-4666-3p	CLIP-seq
MIRT1183978	hsa-miR-4711-5p	CLIP-seq
MIRT1183991	hsa-miR-520d-5p	CLIP-seq
MIRT1183992	hsa-miR-524-5p	CLIP-seq
MIRT1184001	hsa-miR-873	CLIP-seq
MIRT1184002	hsa-miR-889	CLIP-seq
MIRT2053362	hsa-miR-1245	CLIP-seq
MIRT2053363	hsa-miR-1273d	CLIP-seq
MIRT1183947	hsa-miR-221	CLIP-seq
MIRT1183948	hsa-miR-222	CLIP-seq
MIRT1183950	hsa-miR-300	CLIP-seq
MIRT2053364	hsa-miR-3120-3p	CLIP-seq
MIRT2053365	hsa-miR-3145-5p	CLIP-seq
MIRT2053366	hsa-miR-3148	CLIP-seq
MIRT1183957	hsa-miR-323-3p	CLIP-seq
MIRT2053367	hsa-miR-3591-3p	CLIP-seq
MIRT2053368	hsa-miR-3609	CLIP-seq
MIRT1183960	hsa-miR-3646	CLIP-seq
MIRT2053369	hsa-miR-371-5p	CLIP-seq
MIRT2053370	hsa-miR-371b-5p	CLIP-seq
MIRT1183962	hsa-miR-381	CLIP-seq
MIRT2053371	hsa-miR-3973	CLIP-seq
MIRT1183964	hsa-miR-4275	CLIP-seq
MIRT2053372	hsa-miR-4423-3p	CLIP-seq
MIRT2053373	hsa-miR-4470	CLIP-seq
MIRT1183978	hsa-miR-4711-5p	CLIP-seq
MIRT2053374	hsa-miR-483-3p	CLIP-seq
MIRT2053375	hsa-miR-487a	CLIP-seq
MIRT2053376	hsa-miR-520g	CLIP-seq
MIRT2053377	hsa-miR-520h	CLIP-seq
MIRT2053378	hsa-miR-548ah	CLIP-seq
MIRT1184000	hsa-miR-642b	CLIP-seq
MIRT1184001	hsa-miR-873	CLIP-seq
MIRT2053379	hsa-miR-922	CLIP-seq
MIRT1183933	hsa-miR-122	CLIP-seq
MIRT2282582	hsa-miR-1307	CLIP-seq
MIRT2282583	hsa-miR-132	CLIP-seq
MIRT2282584	hsa-miR-136	CLIP-seq
MIRT2282585	hsa-miR-212	CLIP-seq
MIRT1183947	hsa-miR-221	CLIP-seq
MIRT1183948	hsa-miR-222	CLIP-seq
MIRT1183950	hsa-miR-300	CLIP-seq
MIRT1183951	hsa-miR-3124-3p	CLIP-seq
MIRT1183952	hsa-miR-3135b	CLIP-seq
MIRT1183957	hsa-miR-323-3p	CLIP-seq
MIRT2053367	hsa-miR-3591-3p	CLIP-seq
MIRT1183961	hsa-miR-3652	CLIP-seq
MIRT2282586	hsa-miR-3660	CLIP-seq
MIRT2282587	hsa-miR-377	CLIP-seq
MIRT1183962	hsa-miR-381	CLIP-seq
MIRT2282588	hsa-miR-3977	CLIP-seq
MIRT1183964	hsa-miR-4275	CLIP-seq
MIRT2282589	hsa-miR-4284	CLIP-seq
MIRT1183965	hsa-miR-431	CLIP-seq
MIRT1183967	hsa-miR-4430	CLIP-seq
MIRT1183968	hsa-miR-4433	CLIP-seq
MIRT2282590	hsa-miR-4526	CLIP-seq
MIRT2282591	hsa-miR-4634	CLIP-seq
MIRT2282592	hsa-miR-4638-5p	CLIP-seq
MIRT1183972	hsa-miR-4645-3p	CLIP-seq
MIRT1183973	hsa-miR-4666-3p	CLIP-seq
MIRT1183977	hsa-miR-4700-3p	CLIP-seq
MIRT1183978	hsa-miR-4711-5p	CLIP-seq
MIRT2282593	hsa-miR-4764-5p	CLIP-seq
MIRT2282594	hsa-miR-4802-3p	CLIP-seq
MIRT2282595	hsa-miR-490-5p	CLIP-seq
MIRT1183991	hsa-miR-520d-5p	CLIP-seq
MIRT1183992	hsa-miR-524-5p	CLIP-seq
MIRT2282596	hsa-miR-544	CLIP-seq
MIRT1183995	hsa-miR-570	CLIP-seq
MIRT1183996	hsa-miR-592	CLIP-seq
MIRT1183998	hsa-miR-597	CLIP-seq
MIRT2282597	hsa-miR-759	CLIP-seq
MIRT1184001	hsa-miR-873	CLIP-seq
MIRT1184002	hsa-miR-889	CLIP-seq
MIRT1184003	hsa-miR-924	CLIP-seq
MIRT1183934	hsa-miR-1224-5p	CLIP-seq
MIRT1183941	hsa-miR-143	CLIP-seq
MIRT1183947	hsa-miR-221	CLIP-seq
MIRT1183948	hsa-miR-222	CLIP-seq
MIRT1183957	hsa-miR-323-3p	CLIP-seq
MIRT1183964	hsa-miR-4275	CLIP-seq
MIRT1183978	hsa-miR-4711-5p	CLIP-seq
MIRT1183981	hsa-miR-4751	CLIP-seq
MIRT1184001	hsa-miR-873	CLIP-seq
MIRT2580561	hsa-miR-1208	CLIP-seq
MIRT2580562	hsa-miR-141	CLIP-seq
MIRT1183942	hsa-miR-181a	CLIP-seq
MIRT1183943	hsa-miR-181b	CLIP-seq
MIRT1183944	hsa-miR-181c	CLIP-seq
MIRT1183945	hsa-miR-181d	CLIP-seq
MIRT2580563	hsa-miR-200a	CLIP-seq
MIRT2580564	hsa-miR-2053	CLIP-seq
MIRT1183950	hsa-miR-300	CLIP-seq
MIRT2580565	hsa-miR-3065-5p	CLIP-seq
MIRT2580566	hsa-miR-30a	CLIP-seq
MIRT2580567	hsa-miR-30b	CLIP-seq
MIRT2580568	hsa-miR-30c	CLIP-seq
MIRT2580569	hsa-miR-30d	CLIP-seq
MIRT2580570	hsa-miR-30e	CLIP-seq
MIRT1183951	hsa-miR-3124-3p	CLIP-seq
MIRT1183956	hsa-miR-3163	CLIP-seq
MIRT2580571	hsa-miR-3166	CLIP-seq
MIRT1183957	hsa-miR-323-3p	CLIP-seq
MIRT1183958	hsa-miR-338-5p	CLIP-seq
MIRT2580572	hsa-miR-3617	CLIP-seq
MIRT2580573	hsa-miR-3622a-5p	CLIP-seq
MIRT1183960	hsa-miR-3646	CLIP-seq
MIRT2580574	hsa-miR-3662	CLIP-seq
MIRT2580575	hsa-miR-374c	CLIP-seq
MIRT2282587	hsa-miR-377	CLIP-seq
MIRT1183962	hsa-miR-381	CLIP-seq
MIRT2282588	hsa-miR-3977	CLIP-seq
MIRT1183963	hsa-miR-4262	CLIP-seq
MIRT2580576	hsa-miR-4269	CLIP-seq
MIRT2580577	hsa-miR-4272	CLIP-seq
MIRT1183964	hsa-miR-4275	CLIP-seq
MIRT1183968	hsa-miR-4433	CLIP-seq
MIRT2580578	hsa-miR-4436b-3p	CLIP-seq
MIRT2580579	hsa-miR-4494	CLIP-seq
MIRT2580580	hsa-miR-4506	CLIP-seq
MIRT1183972	hsa-miR-4645-3p	CLIP-seq
MIRT1183973	hsa-miR-4666-3p	CLIP-seq
MIRT1183974	hsa-miR-4668-3p	CLIP-seq
MIRT1183977	hsa-miR-4700-3p	CLIP-seq
MIRT1183984	hsa-miR-4797-5p	CLIP-seq
MIRT2580581	hsa-miR-495	CLIP-seq
MIRT2580582	hsa-miR-499a-5p	CLIP-seq
MIRT2282596	hsa-miR-544	CLIP-seq
MIRT2580583	hsa-miR-548a-3p	CLIP-seq
MIRT2580584	hsa-miR-548ag	CLIP-seq
MIRT2580585	hsa-miR-548ai	CLIP-seq
MIRT2580586	hsa-miR-548e	CLIP-seq
MIRT2580587	hsa-miR-548f	CLIP-seq
MIRT2580588	hsa-miR-548m	CLIP-seq
MIRT2580589	hsa-miR-569	CLIP-seq
MIRT2580590	hsa-miR-641	CLIP-seq
MIRT1184000	hsa-miR-642b	CLIP-seq
MIRT2580591	hsa-miR-655	CLIP-seq
MIRT1183950	hsa-miR-300	CLIP-seq
MIRT2580565	hsa-miR-3065-5p	CLIP-seq
MIRT1183956	hsa-miR-3163	CLIP-seq
MIRT2580572	hsa-miR-3617	CLIP-seq
MIRT1183960	hsa-miR-3646	CLIP-seq
MIRT2580574	hsa-miR-3662	CLIP-seq
MIRT2580575	hsa-miR-374c	CLIP-seq
MIRT1183962	hsa-miR-381	CLIP-seq
MIRT1183964	hsa-miR-4275	CLIP-seq
MIRT1183968	hsa-miR-4433	CLIP-seq
MIRT2580579	hsa-miR-4494	CLIP-seq
MIRT1183972	hsa-miR-4645-3p	CLIP-seq
MIRT1183973	hsa-miR-4666-3p	CLIP-seq
MIRT1183974	hsa-miR-4668-3p	CLIP-seq
MIRT1183977	hsa-miR-4700-3p	CLIP-seq
MIRT1183984	hsa-miR-4797-5p	CLIP-seq
MIRT2580581	hsa-miR-495	CLIP-seq
MIRT2580582	hsa-miR-499a-5p	CLIP-seq
MIRT2580583	hsa-miR-548a-3p	CLIP-seq
MIRT2580584	hsa-miR-548ag	CLIP-seq
MIRT2580585	hsa-miR-548ai	CLIP-seq
MIRT2580586	hsa-miR-548e	CLIP-seq
MIRT2580587	hsa-miR-548f	CLIP-seq
MIRT2580588	hsa-miR-548m	CLIP-seq
MIRT2580590	hsa-miR-641	CLIP-seq
MIRT2580591	hsa-miR-655	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	11256944
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11256944
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11306579
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IGI	11306579
GO:0003677	Function	DNA binding	IDA	15243141
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1577736, 1774067
GO:0005515	Function	Protein binding	IPI	12401788, 15243141, 16189514, 16959611, 19223331, 20936779, 21988832, 23332751, 23734815, 25416956, 26496610, 28514442, 32296183, 32814053, 33961781, 35140242
GO:0005634	Component	Nucleus	IDA	11306579, 15243141, 15964792
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15243141
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0016602	Component	CCAAT-binding factor complex	IBA
GO:0016602	Component	CCAAT-binding factor complex	IDA	15243141, 23332751
GO:0016602	Component	CCAAT-binding factor complex	IEA
GO:0016602	Component	CCAAT-binding factor complex	IPI	23332751
GO:0032993	Component	Protein-DNA complex	IDA	11256944
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11306579, 23332751
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	11256944
GO:0140297	Function	DNA-binding transcription factor binding	IPI	19223331
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
189904	7805	ENSG00000120837

P25208

Protein name

Nuclear transcription factor Y subunit beta (CAAT box DNA-binding protein subunit B) (Nuclear transcription factor Y subunit B) (NF-YB)

Protein function

Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on

PDB

1N1J , 4AWL , 4CSR , 6QMP , 6QMQ , 6QMS , 7AH8 , 8QU2 , 8QU3 , 8QU4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00808	CBFD_NFYB_HMF	57 → 122	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	Domain

Sequence

MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF
AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT
TDGQQQNVMVYTTSYQQISGVQQIQFS

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	Antigen processing and presentation Tuberculosis Human T-cell leukemia virus 1 infection		PPARA activates gene expression Activation of gene expression by SREBF (SREBP) ATF6 (ATF6-alpha) activates chaperone genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Agranulocytosis	Agranulocytosis	BEFREE	30814476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31183379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19282111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	25932641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29203250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31205951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31205951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17318641, 19886851, 22679278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22679278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22132193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	26589882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19282111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31922974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18214604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24338397, 36152055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31183379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NFYB (nuclear transcription factor Y subunit beta)