Gene Gene information from NCBI Gene database.
Entrez ID 4792
Gene name NFKB inhibitor alpha
Gene symbol NFKBIA
Synonyms (NCBI Gene)
EDAID2IKBAMAD-3NFKBI
Chromosome 14
Chromosome location 14q13.2
Summary This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protei
SNPs SNP information provided by dbSNP.
10
SNP ID Visualize variation Clinical significance Consequence
rs28933100 C>A,T Pathogenic Coding sequence variant, missense variant
rs121913664 C>T Pathogenic Stop gained, coding sequence variant
rs121913665 C>A Pathogenic Stop gained, coding sequence variant
rs142195196 G>A Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs886041411 G>A Pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
101
miRTarBase ID miRNA Experiments Reference
MIRT003202 kshv-miR-K12-1-5p Luciferase reporter assayWestern blot 20081837
MIRT003202 kshv-miR-K12-1-5p Luciferase reporter assayWestern blot 20081837
MIRT006695 hsa-miR-30e-3p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 22156201
MIRT006695 hsa-miR-30e-3p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 22156201
MIRT017719 hsa-miR-335-5p Microarray 18185580
Transcription factors Transcription factors information provided by TRRUST V2 database.
8
Transcription factor Regulation Reference
NFKB1 Activation 12885753
NFKB1 Repression 11744993
NFKB1 Unknown 10454561;15499023;17876798
PPARA Activation 14976045
PPARA Unknown 11981037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
73
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 16938301
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 9452483, 9520446, 9865693, 10498867, 10733566, 12482991, 12486103, 12656673, 12730857, 14685242, 14743216, 15601829, 15799966, 16126728, 16195219, 16286467, 16319058, 16365431, 16683270, 16951195, 17003112, 17301240, 17318178, 17612295, 18045535, 18539148, 18632959, 18922877, 190083
GO:0005634 Component Nucleus IDA 7679069, 16648481
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
164008 7797 ENSG00000100906
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P25963
Protein name NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)
Protein function Inhibits the activity of dimeric NF-kappa-B/REL complexes by trapping REL (RELA/p65 and NFKB1/p50) dimers in the cytoplasm by masking their nuclear localization signals (PubMed:1493333, PubMed:36651806, PubMed:7479976). On cellular stimulation b
PDB 1IKN , 1NFI , 6TTU , 6Y1J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00023 Ank 111 142 Ankyrin repeat Repeat
PF00023 Ank 143 175 Ankyrin repeat Repeat
PF00023 Ank 182 213 Ankyrin repeat Repeat
PF00023 Ank 216 248 Ankyrin repeat Repeat
Sequence
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDF
RGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTY
QGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
Sequence length 317
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  cAMP signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
C-type lectin receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Adipocytokine signaling pathway
Relaxin signaling pathway
Insulin resistance
Alcoholic liver disease
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Legionellosis
Yersinia infection
Leishmaniasis
Chagas disease
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Viral carcinogenesis
Chemical carcinogenesis - reactive oxygen species
Prostate cancer
Chronic myeloid leukemia
Small cell lung cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  Activation of NF-kappaB in B cells
RIP-mediated NFkB activation via ZBP1
Downstream TCR signaling
NF-kB is activated and signals survival
FCERI mediated NF-kB activation
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
SUMOylation of immune response proteins
IkBA variant leads to EDA-ID
CLEC7A (Dectin-1) signaling
Ub-specific processing proteases
Interleukin-1 signaling
TRAF6 mediated NF-kB activation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
53
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Ectodermal dysplasia and immunodeficiency 2 Pathogenic rs886041411, rs2502188897, rs2502188602, rs28933100, rs121913665, rs1566591076, rs1566591086, rs1566591082 RCV005090329
RCV003325300
RCV003330336
RCV000015040
RCV000015042
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Conflicting classifications of pathogenicity; Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute pancreatitis Pancreatitis BEFREE 10930447
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 12725325
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 15073126
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 10637284, 12525885, 14595753, 15858823, 19223558, 20193848
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma CTD_human_DG 19223558
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 18235219
★☆☆☆☆
Found in Text Mining only
Agammaglobulinemia Agammaglobulinemia BEFREE 15604887
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 31984950 Stimulate
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 37759083 Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophic lateral sclerosis 1 Amyotrophic lateral sclerosis Pubtator 12437573 Associate
★☆☆☆☆
Found in Text Mining only