Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4784
Gene name	Nuclear factor I X
Gene symbol	NFIX
Synonyms (NCBI Gene)	CTFMALNSMRSHSSNF-I/XNF1-XNF1ASOTOS2
Chromosome	19
Chromosome location	19p13.13
Summary	The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5`-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding

Show/Hide all (57)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387907253	C>T	Pathogenic	Stop gained, coding sequence variant
rs387907254	T>C	Pathogenic	Coding sequence variant, missense variant
rs387907255	G>C	Pathogenic	Coding sequence variant, missense variant
rs398122869	TC>-	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs398122870	->T	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs398122871	CTCTC>-	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs398122872	->C	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs398122873	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs398122874	->T	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs398122875	->C	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs398122876	G>A,T	Pathogenic	Splice donor variant
rs587779381	C>G	Pathogenic	Stop gained, coding sequence variant
rs786205515	G>T	Pathogenic	Coding sequence variant, stop gained
rs797044911	C>T	Pathogenic	Missense variant, coding sequence variant
rs797045056	->AGATC	Pathogenic	Frameshift variant, coding sequence variant
rs797045737	GAGCCCCCGGGCCACAG>-	Pathogenic	Frameshift variant, coding sequence variant
rs797045738	AA>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs886039698	ATGCA>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041304	C>-,CC	Pathogenic	Frameshift variant, coding sequence variant
rs886041422	C>T	Pathogenic	Coding sequence variant, stop gained
rs886041432	->C	Pathogenic	Frameshift variant, coding sequence variant
rs886041647	->C	Pathogenic	Frameshift variant, coding sequence variant
rs886041792	G>A	Pathogenic	Coding sequence variant, stop gained
rs886041828	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1057517936	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057518152	G>A	Pathogenic	Splice donor variant
rs1064796288	GG>C	Pathogenic	Coding sequence variant, frameshift variant
rs1085307714	G>-	Pathogenic	Coding sequence variant, splice acceptor variant
rs1135401802	G>-	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant
rs1555696499	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1555696536	->TC	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1555696587	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1555696597	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1555696603	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555696606	G>A,C	Likely-pathogenic, likely-benign	Coding sequence variant, synonymous variant
rs1555696611	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555696625	G>A	Pathogenic	Coding sequence variant, missense variant
rs1555696641	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1555696660	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1555705276	C>T	Pathogenic	Coding sequence variant, stop gained
rs1555705733	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1555707363	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1568268397	A>T	Pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs1568269273	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1568318540	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1568318932	T>C,G	Likely-pathogenic	Splice donor variant
rs1599737421	->TTCATCG	Pathogenic	Frameshift variant, coding sequence variant, 5 prime UTR variant
rs1599737896	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1599738036	A>T	Pathogenic	Coding sequence variant, stop gained
rs1599738349	CCAGAAGGGCAAGA>-	Pathogenic	Frameshift variant, coding sequence variant
rs1599738398	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1599738608	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1599844887	ACCTCCCCTCCTTC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1599848690	GTGGCCCAACG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1599855670	AG>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant
rs1599862139	->CCAGCAG	Pathogenic	Frameshift variant, coding sequence variant
rs1599862357	->G	Pathogenic	Frameshift variant, coding sequence variant

604

Show/Hide all (604)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004316	hsa-miR-223-3p	Luciferase reporter assay	19850724
MIRT023216	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT045644	hsa-miR-149-5p	CLASH	23622248
MIRT043206	hsa-miR-324-5p	CLASH	23622248
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT570602	hsa-miR-6801-3p	PAR-CLIP	20371350
MIRT570601	hsa-miR-6810-3p	PAR-CLIP	20371350
MIRT570599	hsa-miR-4734	PAR-CLIP	20371350
MIRT570598	hsa-miR-6846-3p	PAR-CLIP	20371350
MIRT574578	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT574579	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT570595	hsa-miR-4706	PAR-CLIP	20371350
MIRT570594	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT570593	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT492879	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT492877	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT492876	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT492875	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT570592	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT570591	hsa-miR-3144-5p	PAR-CLIP	20371350
MIRT574577	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT570590	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT570589	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT492890	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT492889	hsa-miR-4419a	PAR-CLIP	20371350
MIRT492888	hsa-miR-4510	PAR-CLIP	20371350
MIRT492887	hsa-miR-6127	PAR-CLIP	20371350
MIRT492885	hsa-miR-6129	PAR-CLIP	20371350
MIRT492886	hsa-miR-6130	PAR-CLIP	20371350
MIRT492884	hsa-miR-6133	PAR-CLIP	20371350
MIRT492883	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT492882	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT492881	hsa-miR-7150	PAR-CLIP	20371350
MIRT570602	hsa-miR-6801-3p	PAR-CLIP	20371350
MIRT570601	hsa-miR-6810-3p	PAR-CLIP	20371350
MIRT570600	hsa-miR-6752-3p	PAR-CLIP	20371350
MIRT570599	hsa-miR-4734	PAR-CLIP	20371350
MIRT570598	hsa-miR-6846-3p	PAR-CLIP	20371350
MIRT570597	hsa-miR-6869-3p	PAR-CLIP	20371350
MIRT570596	hsa-miR-3648	PAR-CLIP	20371350
MIRT570595	hsa-miR-4706	PAR-CLIP	20371350
MIRT570594	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT570593	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT570592	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT570591	hsa-miR-3144-5p	PAR-CLIP	20371350
MIRT570590	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT570589	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT023216	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT406559	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT023216	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT566641	hsa-miR-3714	PAR-CLIP	20371350
MIRT566640	hsa-miR-3910	PAR-CLIP	20371350
MIRT406564	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT406562	hsa-miR-4459	PAR-CLIP	20371350
MIRT406560	hsa-miR-765	PAR-CLIP	20371350
MIRT492892	hsa-miR-1321	PAR-CLIP	23592263
MIRT492893	hsa-miR-4739	PAR-CLIP	23592263
MIRT492891	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT492890	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT492889	hsa-miR-4419a	PAR-CLIP	23592263
MIRT492888	hsa-miR-4510	PAR-CLIP	23592263
MIRT492887	hsa-miR-6127	PAR-CLIP	23592263
MIRT492885	hsa-miR-6129	PAR-CLIP	23592263
MIRT492886	hsa-miR-6130	PAR-CLIP	23592263
MIRT492884	hsa-miR-6133	PAR-CLIP	23592263
MIRT492883	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT492882	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT492881	hsa-miR-7150	PAR-CLIP	23592263
MIRT492880	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT492878	hsa-miR-6789-3p	PAR-CLIP	23592263
MIRT492879	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492877	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492876	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492875	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492874	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT492873	hsa-miR-4488	PAR-CLIP	23592263
MIRT492872	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT492871	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT492870	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT492869	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT492868	hsa-miR-6745	PAR-CLIP	23592263
MIRT492866	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT492867	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT492865	hsa-miR-1293	PAR-CLIP	23592263
MIRT492864	hsa-miR-4483	PAR-CLIP	23592263
MIRT492863	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT492862	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT492861	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT492860	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT492859	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT023216	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT492883	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT492883	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT574578	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT566641	hsa-miR-3714	PAR-CLIP	26701625
MIRT566640	hsa-miR-3910	PAR-CLIP	26701625
MIRT574579	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT492889	hsa-miR-4419a	PAR-CLIP	26701625
MIRT492889	hsa-miR-4419a	PAR-CLIP	26701625
MIRT406562	hsa-miR-4459	PAR-CLIP	26701625
MIRT492888	hsa-miR-4510	PAR-CLIP	26701625
MIRT492888	hsa-miR-4510	PAR-CLIP	26701625
MIRT406559	hsa-miR-506-3p	PAR-CLIP	26701625
MIRT406564	hsa-miR-5582-5p	PAR-CLIP	26701625
MIRT492887	hsa-miR-6127	PAR-CLIP	26701625
MIRT492887	hsa-miR-6127	PAR-CLIP	26701625
MIRT492885	hsa-miR-6129	PAR-CLIP	26701625
MIRT492885	hsa-miR-6129	PAR-CLIP	26701625
MIRT492886	hsa-miR-6130	PAR-CLIP	26701625
MIRT492886	hsa-miR-6130	PAR-CLIP	26701625
MIRT492884	hsa-miR-6133	PAR-CLIP	26701625
MIRT492884	hsa-miR-6133	PAR-CLIP	26701625
MIRT492882	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT492882	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT406560	hsa-miR-765	PAR-CLIP	26701625
MIRT492863	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610735	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT610734	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT610733	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT610732	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT610731	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT570602	hsa-miR-6801-3p	PAR-CLIP	20371350
MIRT570601	hsa-miR-6810-3p	PAR-CLIP	20371350
MIRT570599	hsa-miR-4734	PAR-CLIP	20371350
MIRT570598	hsa-miR-6846-3p	PAR-CLIP	20371350
MIRT574578	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT574579	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT570595	hsa-miR-4706	PAR-CLIP	20371350
MIRT570594	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT570593	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT492879	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT492877	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT492876	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT492875	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT570592	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT570591	hsa-miR-3144-5p	PAR-CLIP	20371350
MIRT574577	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT570590	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT570589	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT492890	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT492889	hsa-miR-4419a	PAR-CLIP	20371350
MIRT492888	hsa-miR-4510	PAR-CLIP	20371350
MIRT492887	hsa-miR-6127	PAR-CLIP	20371350
MIRT492885	hsa-miR-6129	PAR-CLIP	20371350
MIRT492886	hsa-miR-6130	PAR-CLIP	20371350
MIRT492884	hsa-miR-6133	PAR-CLIP	20371350
MIRT492883	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT492882	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT492881	hsa-miR-7150	PAR-CLIP	20371350
MIRT570602	hsa-miR-6801-3p	PAR-CLIP	20371350
MIRT570601	hsa-miR-6810-3p	PAR-CLIP	20371350
MIRT570600	hsa-miR-6752-3p	PAR-CLIP	20371350
MIRT570599	hsa-miR-4734	PAR-CLIP	20371350
MIRT570598	hsa-miR-6846-3p	PAR-CLIP	20371350
MIRT570597	hsa-miR-6869-3p	PAR-CLIP	20371350
MIRT570596	hsa-miR-3648	PAR-CLIP	20371350
MIRT570595	hsa-miR-4706	PAR-CLIP	20371350
MIRT570594	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT570593	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT570592	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT570591	hsa-miR-3144-5p	PAR-CLIP	20371350
MIRT570590	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT570589	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT023216	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT406559	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT023216	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT566641	hsa-miR-3714	PAR-CLIP	20371350
MIRT566640	hsa-miR-3910	PAR-CLIP	20371350
MIRT406564	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT406562	hsa-miR-4459	PAR-CLIP	20371350
MIRT406560	hsa-miR-765	PAR-CLIP	20371350
MIRT492892	hsa-miR-1321	PAR-CLIP	23592263
MIRT492893	hsa-miR-4739	PAR-CLIP	23592263
MIRT492891	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT492890	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT492889	hsa-miR-4419a	PAR-CLIP	23592263
MIRT492888	hsa-miR-4510	PAR-CLIP	23592263
MIRT492887	hsa-miR-6127	PAR-CLIP	23592263
MIRT492885	hsa-miR-6129	PAR-CLIP	23592263
MIRT492886	hsa-miR-6130	PAR-CLIP	23592263
MIRT492884	hsa-miR-6133	PAR-CLIP	23592263
MIRT492883	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT492882	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT492881	hsa-miR-7150	PAR-CLIP	23592263
MIRT492880	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT492878	hsa-miR-6789-3p	PAR-CLIP	23592263
MIRT492879	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492877	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492876	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492875	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492874	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT492873	hsa-miR-4488	PAR-CLIP	23592263
MIRT492872	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT492871	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT492870	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT492869	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT492868	hsa-miR-6745	PAR-CLIP	23592263
MIRT492866	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT492867	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT492865	hsa-miR-1293	PAR-CLIP	23592263
MIRT492864	hsa-miR-4483	PAR-CLIP	23592263
MIRT492863	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT492862	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT492861	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT492860	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT492859	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT1183280	hsa-miR-1236	CLIP-seq
MIRT1183281	hsa-miR-1247	CLIP-seq
MIRT1183282	hsa-miR-1254	CLIP-seq
MIRT1183283	hsa-miR-1255a	CLIP-seq
MIRT1183284	hsa-miR-1255b	CLIP-seq
MIRT1183285	hsa-miR-1265	CLIP-seq
MIRT1183286	hsa-miR-1266	CLIP-seq
MIRT1183287	hsa-miR-1276	CLIP-seq
MIRT1183288	hsa-miR-1302	CLIP-seq
MIRT1183289	hsa-miR-1324	CLIP-seq
MIRT1183290	hsa-miR-136	CLIP-seq
MIRT1183291	hsa-miR-1470	CLIP-seq
MIRT1183292	hsa-miR-1538	CLIP-seq
MIRT1183293	hsa-miR-185	CLIP-seq
MIRT1183294	hsa-miR-1908	CLIP-seq
MIRT1183295	hsa-miR-2277-5p	CLIP-seq
MIRT1183296	hsa-miR-2392	CLIP-seq
MIRT1183297	hsa-miR-23a	CLIP-seq
MIRT1183298	hsa-miR-23b	CLIP-seq
MIRT1183299	hsa-miR-23c	CLIP-seq
MIRT1183300	hsa-miR-29a	CLIP-seq
MIRT1183301	hsa-miR-29b	CLIP-seq
MIRT1183302	hsa-miR-29c	CLIP-seq
MIRT1183303	hsa-miR-3116	CLIP-seq
MIRT1183304	hsa-miR-3126-5p	CLIP-seq
MIRT1183305	hsa-miR-3136-3p	CLIP-seq
MIRT1183306	hsa-miR-3143	CLIP-seq
MIRT1183307	hsa-miR-3153	CLIP-seq
MIRT1183308	hsa-miR-3175	CLIP-seq
MIRT1183309	hsa-miR-3180	CLIP-seq
MIRT1183310	hsa-miR-3180-3p	CLIP-seq
MIRT1183311	hsa-miR-3184	CLIP-seq
MIRT1183312	hsa-miR-3189-5p	CLIP-seq
MIRT1183313	hsa-miR-3192	CLIP-seq
MIRT1183314	hsa-miR-3195	CLIP-seq
MIRT1183315	hsa-miR-3196	CLIP-seq
MIRT1183316	hsa-miR-323-3p	CLIP-seq
MIRT1183317	hsa-miR-342-5p	CLIP-seq
MIRT1183318	hsa-miR-3612	CLIP-seq
MIRT1183319	hsa-miR-3617	CLIP-seq
MIRT1183320	hsa-miR-365	CLIP-seq
MIRT1183321	hsa-miR-3653	CLIP-seq
MIRT1183322	hsa-miR-3656	CLIP-seq
MIRT1183323	hsa-miR-3667-5p	CLIP-seq
MIRT1183324	hsa-miR-3677-5p	CLIP-seq
MIRT1183325	hsa-miR-374a	CLIP-seq
MIRT1183326	hsa-miR-374b	CLIP-seq
MIRT1183327	hsa-miR-3919	CLIP-seq
MIRT1183328	hsa-miR-409-3p	CLIP-seq
MIRT1183329	hsa-miR-4269	CLIP-seq
MIRT1183330	hsa-miR-4293	CLIP-seq
MIRT1183331	hsa-miR-4298	CLIP-seq
MIRT1183332	hsa-miR-4306	CLIP-seq
MIRT1183333	hsa-miR-4311	CLIP-seq
MIRT1183334	hsa-miR-4314	CLIP-seq
MIRT1183335	hsa-miR-4426	CLIP-seq
MIRT1183336	hsa-miR-4434	CLIP-seq
MIRT1183337	hsa-miR-4443	CLIP-seq
MIRT1183338	hsa-miR-4447	CLIP-seq
MIRT1183339	hsa-miR-4469	CLIP-seq
MIRT1183340	hsa-miR-4472	CLIP-seq
MIRT1183341	hsa-miR-4496	CLIP-seq
MIRT1183342	hsa-miR-4508	CLIP-seq
MIRT1183343	hsa-miR-4514	CLIP-seq
MIRT1183344	hsa-miR-4516	CLIP-seq
MIRT1183345	hsa-miR-4518	CLIP-seq
MIRT1183346	hsa-miR-4531	CLIP-seq
MIRT1183347	hsa-miR-4638-5p	CLIP-seq
MIRT1183348	hsa-miR-4643	CLIP-seq
MIRT1183349	hsa-miR-4644	CLIP-seq
MIRT1183350	hsa-miR-4645-3p	CLIP-seq
MIRT1183351	hsa-miR-4646-5p	CLIP-seq
MIRT1183352	hsa-miR-4647	CLIP-seq
MIRT1183353	hsa-miR-4651	CLIP-seq
MIRT1183354	hsa-miR-466	CLIP-seq
MIRT1183355	hsa-miR-4661-5p	CLIP-seq
MIRT1183356	hsa-miR-4662a-3p	CLIP-seq
MIRT1183357	hsa-miR-4662a-5p	CLIP-seq
MIRT1183358	hsa-miR-4662b	CLIP-seq
MIRT1183359	hsa-miR-4664-5p	CLIP-seq
MIRT1183360	hsa-miR-4665-3p	CLIP-seq
MIRT1183361	hsa-miR-4667-3p	CLIP-seq
MIRT1183362	hsa-miR-4692	CLIP-seq
MIRT1183363	hsa-miR-4701-5p	CLIP-seq
MIRT1183364	hsa-miR-4712-3p	CLIP-seq
MIRT1183365	hsa-miR-4723-5p	CLIP-seq
MIRT1183366	hsa-miR-4733-3p	CLIP-seq
MIRT1183367	hsa-miR-4738-5p	CLIP-seq
MIRT1183368	hsa-miR-4742-5p	CLIP-seq
MIRT1183369	hsa-miR-4745-3p	CLIP-seq
MIRT1183370	hsa-miR-4747-3p	CLIP-seq
MIRT1183371	hsa-miR-4758-3p	CLIP-seq
MIRT1183372	hsa-miR-4781-5p	CLIP-seq
MIRT1183373	hsa-miR-4789-3p	CLIP-seq
MIRT1183374	hsa-miR-4790-3p	CLIP-seq
MIRT1183375	hsa-miR-4796-3p	CLIP-seq
MIRT1183376	hsa-miR-4803	CLIP-seq
MIRT1183377	hsa-miR-483-3p	CLIP-seq
MIRT1183378	hsa-miR-485-5p	CLIP-seq
MIRT1183379	hsa-miR-486-3p	CLIP-seq
MIRT1183380	hsa-miR-516b	CLIP-seq
MIRT1183381	hsa-miR-520a-5p	CLIP-seq
MIRT1183382	hsa-miR-520d-5p	CLIP-seq
MIRT1183383	hsa-miR-524-5p	CLIP-seq
MIRT1183384	hsa-miR-525-5p	CLIP-seq
MIRT1183385	hsa-miR-541	CLIP-seq
MIRT1183386	hsa-miR-544b	CLIP-seq
MIRT1183387	hsa-miR-548ad	CLIP-seq
MIRT1183388	hsa-miR-548t	CLIP-seq
MIRT1183389	hsa-miR-548u	CLIP-seq
MIRT1183390	hsa-miR-555	CLIP-seq
MIRT1183391	hsa-miR-583	CLIP-seq
MIRT1183392	hsa-miR-588	CLIP-seq
MIRT1183393	hsa-miR-608	CLIP-seq
MIRT1183394	hsa-miR-625	CLIP-seq
MIRT1183395	hsa-miR-641	CLIP-seq
MIRT1183396	hsa-miR-642a	CLIP-seq
MIRT1183397	hsa-miR-650	CLIP-seq
MIRT1183398	hsa-miR-653	CLIP-seq
MIRT1183399	hsa-miR-661	CLIP-seq
MIRT1183400	hsa-miR-663	CLIP-seq
MIRT1183401	hsa-miR-668	CLIP-seq
MIRT1183402	hsa-miR-671-3p	CLIP-seq
MIRT1183403	hsa-miR-744	CLIP-seq
MIRT1551742	hsa-miR-1197	CLIP-seq
MIRT1551743	hsa-miR-1278	CLIP-seq
MIRT1551744	hsa-miR-24	CLIP-seq
MIRT1183308	hsa-miR-3175	CLIP-seq
MIRT1183309	hsa-miR-3180	CLIP-seq
MIRT1183310	hsa-miR-3180-3p	CLIP-seq
MIRT1183311	hsa-miR-3184	CLIP-seq
MIRT1183315	hsa-miR-3196	CLIP-seq
MIRT1551745	hsa-miR-33a	CLIP-seq
MIRT1551746	hsa-miR-33b	CLIP-seq
MIRT1551747	hsa-miR-455-3p	CLIP-seq
MIRT1183353	hsa-miR-4651	CLIP-seq
MIRT1551748	hsa-miR-4716-3p	CLIP-seq
MIRT1183365	hsa-miR-4723-5p	CLIP-seq
MIRT1551749	hsa-miR-572	CLIP-seq
MIRT1183393	hsa-miR-608	CLIP-seq
MIRT1183394	hsa-miR-625	CLIP-seq
MIRT1551750	hsa-miR-885-5p	CLIP-seq
MIRT1183353	hsa-miR-4651	CLIP-seq
MIRT1183393	hsa-miR-608	CLIP-seq
MIRT2053134	hsa-miR-10a	CLIP-seq
MIRT2053135	hsa-miR-10b	CLIP-seq
MIRT2053136	hsa-miR-1207-3p	CLIP-seq
MIRT2053137	hsa-miR-1252	CLIP-seq
MIRT1183282	hsa-miR-1254	CLIP-seq
MIRT1183286	hsa-miR-1266	CLIP-seq
MIRT1183288	hsa-miR-1302	CLIP-seq
MIRT2053138	hsa-miR-137	CLIP-seq
MIRT1183291	hsa-miR-1470	CLIP-seq
MIRT1183293	hsa-miR-185	CLIP-seq
MIRT1183294	hsa-miR-1908	CLIP-seq
MIRT1551744	hsa-miR-24	CLIP-seq
MIRT2053139	hsa-miR-2467-3p	CLIP-seq
MIRT1183303	hsa-miR-3116	CLIP-seq
MIRT2053140	hsa-miR-3127-3p	CLIP-seq
MIRT2053141	hsa-miR-3135b	CLIP-seq
MIRT2053142	hsa-miR-3150b-3p	CLIP-seq
MIRT2053143	hsa-miR-3151	CLIP-seq
MIRT2053144	hsa-miR-3154	CLIP-seq
MIRT2053145	hsa-miR-3164	CLIP-seq
MIRT2053146	hsa-miR-3173-3p	CLIP-seq
MIRT1183308	hsa-miR-3175	CLIP-seq
MIRT1183309	hsa-miR-3180	CLIP-seq
MIRT1183310	hsa-miR-3180-3p	CLIP-seq
MIRT1183311	hsa-miR-3184	CLIP-seq
MIRT1183313	hsa-miR-3192	CLIP-seq
MIRT1183315	hsa-miR-3196	CLIP-seq
MIRT1183317	hsa-miR-342-5p	CLIP-seq
MIRT1183318	hsa-miR-3612	CLIP-seq
MIRT2053147	hsa-miR-3652	CLIP-seq
MIRT1183321	hsa-miR-3653	CLIP-seq
MIRT2053148	hsa-miR-3929	CLIP-seq
MIRT2053149	hsa-miR-3936	CLIP-seq
MIRT1183329	hsa-miR-4269	CLIP-seq
MIRT2053150	hsa-miR-4271	CLIP-seq
MIRT1183331	hsa-miR-4298	CLIP-seq
MIRT1183332	hsa-miR-4306	CLIP-seq
MIRT1183333	hsa-miR-4311	CLIP-seq
MIRT1183334	hsa-miR-4314	CLIP-seq
MIRT2053151	hsa-miR-4419b	CLIP-seq
MIRT2053152	hsa-miR-4430	CLIP-seq
MIRT1183337	hsa-miR-4443	CLIP-seq
MIRT2053153	hsa-miR-4446-3p	CLIP-seq
MIRT2053154	hsa-miR-4457	CLIP-seq
MIRT2053155	hsa-miR-4468	CLIP-seq
MIRT2053156	hsa-miR-4478	CLIP-seq
MIRT1183342	hsa-miR-4508	CLIP-seq
MIRT1183345	hsa-miR-4518	CLIP-seq
MIRT2053157	hsa-miR-4640-3p	CLIP-seq
MIRT1183349	hsa-miR-4644	CLIP-seq
MIRT1183351	hsa-miR-4646-5p	CLIP-seq
MIRT1183353	hsa-miR-4651	CLIP-seq
MIRT2053158	hsa-miR-4659a-3p	CLIP-seq
MIRT2053159	hsa-miR-4659b-3p	CLIP-seq
MIRT1183355	hsa-miR-4661-5p	CLIP-seq
MIRT1183359	hsa-miR-4664-5p	CLIP-seq
MIRT1183361	hsa-miR-4667-3p	CLIP-seq
MIRT2053160	hsa-miR-4675	CLIP-seq
MIRT2053161	hsa-miR-4707-5p	CLIP-seq
MIRT1551748	hsa-miR-4716-3p	CLIP-seq
MIRT1183365	hsa-miR-4723-5p	CLIP-seq
MIRT2053162	hsa-miR-4725-3p	CLIP-seq
MIRT2053163	hsa-miR-4725-5p	CLIP-seq
MIRT2053164	hsa-miR-4731-5p	CLIP-seq
MIRT2053165	hsa-miR-4741	CLIP-seq
MIRT2053166	hsa-miR-4755-3p	CLIP-seq
MIRT2053167	hsa-miR-4784	CLIP-seq
MIRT2053168	hsa-miR-4786-5p	CLIP-seq
MIRT2053169	hsa-miR-4793-5p	CLIP-seq
MIRT1183379	hsa-miR-486-3p	CLIP-seq
MIRT2053170	hsa-miR-504	CLIP-seq
MIRT2053171	hsa-miR-542-5p	CLIP-seq
MIRT1183390	hsa-miR-555	CLIP-seq
MIRT1183393	hsa-miR-608	CLIP-seq
MIRT1183394	hsa-miR-625	CLIP-seq
MIRT2053172	hsa-miR-637	CLIP-seq
MIRT1183397	hsa-miR-650	CLIP-seq
MIRT1183399	hsa-miR-661	CLIP-seq
MIRT1183400	hsa-miR-663	CLIP-seq
MIRT1183403	hsa-miR-744	CLIP-seq
MIRT2053173	hsa-miR-873	CLIP-seq
MIRT2053174	hsa-miR-939	CLIP-seq
MIRT2053175	hsa-miR-942	CLIP-seq
MIRT2053136	hsa-miR-1207-3p	CLIP-seq
MIRT1183288	hsa-miR-1302	CLIP-seq
MIRT1183293	hsa-miR-185	CLIP-seq
MIRT1183294	hsa-miR-1908	CLIP-seq
MIRT2053139	hsa-miR-2467-3p	CLIP-seq
MIRT2053140	hsa-miR-3127-3p	CLIP-seq
MIRT2053144	hsa-miR-3154	CLIP-seq
MIRT1183308	hsa-miR-3175	CLIP-seq
MIRT1183309	hsa-miR-3180	CLIP-seq
MIRT1183310	hsa-miR-3180-3p	CLIP-seq
MIRT1183311	hsa-miR-3184	CLIP-seq
MIRT2282454	hsa-miR-3191	CLIP-seq
MIRT1183313	hsa-miR-3192	CLIP-seq
MIRT2282455	hsa-miR-3194-5p	CLIP-seq
MIRT1183315	hsa-miR-3196	CLIP-seq
MIRT1551745	hsa-miR-33a	CLIP-seq
MIRT1551746	hsa-miR-33b	CLIP-seq
MIRT1183317	hsa-miR-342-5p	CLIP-seq
MIRT2282456	hsa-miR-3616-3p	CLIP-seq
MIRT1183327	hsa-miR-3919	CLIP-seq
MIRT2282457	hsa-miR-3924	CLIP-seq
MIRT2282458	hsa-miR-4254	CLIP-seq
MIRT1183329	hsa-miR-4269	CLIP-seq
MIRT2282459	hsa-miR-4270	CLIP-seq
MIRT2053150	hsa-miR-4271	CLIP-seq
MIRT1183331	hsa-miR-4298	CLIP-seq
MIRT1183332	hsa-miR-4306	CLIP-seq
MIRT2282460	hsa-miR-4308	CLIP-seq
MIRT1183333	hsa-miR-4311	CLIP-seq
MIRT1183334	hsa-miR-4314	CLIP-seq
MIRT2282461	hsa-miR-4436b-3p	CLIP-seq
MIRT2282462	hsa-miR-4441	CLIP-seq
MIRT2053154	hsa-miR-4457	CLIP-seq
MIRT2053155	hsa-miR-4468	CLIP-seq
MIRT2282463	hsa-miR-4474-3p	CLIP-seq
MIRT1183342	hsa-miR-4508	CLIP-seq
MIRT1183349	hsa-miR-4644	CLIP-seq
MIRT1183351	hsa-miR-4646-5p	CLIP-seq
MIRT1183353	hsa-miR-4651	CLIP-seq
MIRT1183355	hsa-miR-4661-5p	CLIP-seq
MIRT1183359	hsa-miR-4664-5p	CLIP-seq
MIRT2282464	hsa-miR-4691-3p	CLIP-seq
MIRT1551748	hsa-miR-4716-3p	CLIP-seq
MIRT1183365	hsa-miR-4723-5p	CLIP-seq
MIRT2053162	hsa-miR-4725-3p	CLIP-seq
MIRT2282465	hsa-miR-4787-5p	CLIP-seq
MIRT1183393	hsa-miR-608	CLIP-seq
MIRT1183400	hsa-miR-663	CLIP-seq
MIRT1183403	hsa-miR-744	CLIP-seq
MIRT2391528	hsa-miR-138	CLIP-seq
MIRT1183293	hsa-miR-185	CLIP-seq
MIRT2391529	hsa-miR-218	CLIP-seq
MIRT2391530	hsa-miR-219-2-3p	CLIP-seq
MIRT2053141	hsa-miR-3135b	CLIP-seq
MIRT2053142	hsa-miR-3150b-3p	CLIP-seq
MIRT1183311	hsa-miR-3184	CLIP-seq
MIRT1183313	hsa-miR-3192	CLIP-seq
MIRT1183317	hsa-miR-342-5p	CLIP-seq
MIRT2053147	hsa-miR-3652	CLIP-seq
MIRT1183327	hsa-miR-3919	CLIP-seq
MIRT1183329	hsa-miR-4269	CLIP-seq
MIRT1183332	hsa-miR-4306	CLIP-seq
MIRT1183334	hsa-miR-4314	CLIP-seq
MIRT1183335	hsa-miR-4426	CLIP-seq
MIRT2053152	hsa-miR-4430	CLIP-seq
MIRT1183336	hsa-miR-4434	CLIP-seq
MIRT1183338	hsa-miR-4447	CLIP-seq
MIRT1183340	hsa-miR-4472	CLIP-seq
MIRT1183343	hsa-miR-4514	CLIP-seq
MIRT1183344	hsa-miR-4516	CLIP-seq
MIRT1183346	hsa-miR-4531	CLIP-seq
MIRT2053157	hsa-miR-4640-3p	CLIP-seq
MIRT1183349	hsa-miR-4644	CLIP-seq
MIRT1183351	hsa-miR-4646-5p	CLIP-seq
MIRT1183352	hsa-miR-4647	CLIP-seq
MIRT1183353	hsa-miR-4651	CLIP-seq
MIRT1183358	hsa-miR-4662b	CLIP-seq
MIRT1183359	hsa-miR-4664-5p	CLIP-seq
MIRT1183361	hsa-miR-4667-3p	CLIP-seq
MIRT1183362	hsa-miR-4692	CLIP-seq
MIRT2391531	hsa-miR-4707-3p	CLIP-seq
MIRT2053161	hsa-miR-4707-5p	CLIP-seq
MIRT1183365	hsa-miR-4723-5p	CLIP-seq
MIRT1183368	hsa-miR-4742-5p	CLIP-seq
MIRT2053167	hsa-miR-4784	CLIP-seq
MIRT2282465	hsa-miR-4787-5p	CLIP-seq
MIRT2053171	hsa-miR-542-5p	CLIP-seq
MIRT1183393	hsa-miR-608	CLIP-seq
MIRT1183403	hsa-miR-744	CLIP-seq
MIRT2438985	hsa-miR-1203	CLIP-seq
MIRT2438986	hsa-miR-4274	CLIP-seq
MIRT1551747	hsa-miR-455-3p	CLIP-seq
MIRT2053158	hsa-miR-4659a-3p	CLIP-seq
MIRT2053159	hsa-miR-4659b-3p	CLIP-seq
MIRT2438987	hsa-miR-4743	CLIP-seq
MIRT2053175	hsa-miR-942	CLIP-seq
MIRT2438985	hsa-miR-1203	CLIP-seq
MIRT2442409	hsa-miR-1976	CLIP-seq
MIRT2438986	hsa-miR-4274	CLIP-seq
MIRT2442410	hsa-miR-4286	CLIP-seq
MIRT2442411	hsa-miR-4423-5p	CLIP-seq
MIRT1551747	hsa-miR-455-3p	CLIP-seq
MIRT2438987	hsa-miR-4743	CLIP-seq
MIRT2580497	hsa-miR-1233	CLIP-seq
MIRT2580498	hsa-miR-188-3p	CLIP-seq
MIRT2580499	hsa-miR-4687-5p	CLIP-seq
MIRT2580500	hsa-miR-615-3p	CLIP-seq
MIRT2580497	hsa-miR-1233	CLIP-seq
MIRT2580498	hsa-miR-188-3p	CLIP-seq
MIRT2580499	hsa-miR-4687-5p	CLIP-seq
MIRT2580500	hsa-miR-615-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19706729
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	TAS	7937100
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7590749, 8340106
GO:0005515	Function	Protein binding	IPI	21953450, 25416956, 26871637, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	7937100
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19706729
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
164005	7788	ENSG00000008441

Q14938

Protein name

Nuclear factor 1 X-type (NF1-X) (Nuclear factor 1/X) (CCAAT-box-binding transcription factor) (CTF) (Nuclear factor I/X) (NF-I/X) (NFI-X) (TGGCA-binding protein)

Protein function

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replicatio

PDB

7QQD , 7QQE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10524	NfI_DNAbd_pre-N	7 → 46	Nuclear factor I protein pre-N-terminus	Family
PF03165	MH1	68 → 172	MH1 domain	Domain
PF00859	CTF_NFI	213 → 502	CTF/NF-I family transcription modulation region	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:20673863}.

Sequence

MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDEL
LGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCL
RQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLA
YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASG
PNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGR
SPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPG
SPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPN
GSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRF
VSIGPRDGNFLNIPQQSQSWFL

Sequence length

502

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability	Likely pathogenic; Pathogenic	rs2013246660, rs2013265950	RCV001257605 RCV001257606	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malan overgrowth syndrome	Pathogenic; Likely pathogenic	rs760493118, rs2145192570, rs2145192745, rs2145192459, rs2145476207, rs2145190803, rs2145443002, rs2145430763, rs2145459429, rs2145191473, rs1326313565, rs2145191979, rs2145434937, rs2512743361, rs2512745631 View all (46 more)	RCV001384392 RCV001390439 RCV002544267 RCV001785348 RCV001808844 View all (58 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marfanoid habitus and intellectual disability	Likely pathogenic; Pathogenic	rs1555696597, rs1599738398	RCV000850427 RCV000850473	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marshall-Smith syndrome	Pathogenic; Likely pathogenic	rs760493118, rs2145192570, rs2145432885, rs2145192041, rs2145192745, rs2145442806, rs2145430763, rs2145459429, rs2145191473, rs2145191618, rs2145191979, rs2512746910, rs2512747813, rs2512978311, rs2512965561 View all (42 more)	RCV001384392 RCV001390439 RCV001771788 RCV001775416 RCV002544267 View all (53 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs1599862464	RCV003389172	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NFIX-related disorder	Likely pathogenic; Pathogenic	rs2145192570, rs886041647, rs1555696603	RCV004753305 RCV003417876 RCV003403568	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
19P13.3 MICRODUPLICATION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOBAL DEVELOPMENTAL DELAY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALAN SYNDROME	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STRABISMUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (125)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
19p13.3 microduplication syndrome	19p13.3 microduplication syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30418046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27430330, 31771065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22925353, 28115744		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22925353		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	28115744		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	28115744	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31843555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	20673863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	31730271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28800311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	26509926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31843555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36060149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23360797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	35791460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Choanal Atresia	Choanal Atresia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33034087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28990086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	30388402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital keratoglobus	Congenital Keratoglobus	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital omphalocele	Congenital omphalocele	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis marmorata	Cutis marmorata	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	22170863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Developmental disability	Pubtator	20673863, 31088393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29070574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	20847428, 31479861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	31730271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic Ataxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23360797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28800311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	11557046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36469009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30072869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glossoptosis	Glossoptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	29184170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	Pubtator	37316562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	17353270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of optic disc	Hypoplasia Of Optic Disc	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23948903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29184170, 30388402		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	29184170, 31088393	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	17353270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngomalacia	Laryngomalacia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngomalacia	Laryngomalacia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36094501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28800311	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	29184170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malan overgrowth syndrome	Malan Overgrowth Syndrome	CLINVAR_DG	20673863, 24375697, 25118028, 26633545		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malan overgrowth syndrome	Malan Overgrowth Syndrome	GENOMICS_ENGLAND_DG	20673863, 25118028		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malan overgrowth syndrome	Malan Overgrowth Syndrome	ORPHANET_DG	20673863, 22301465, 25118028		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malan overgrowth syndrome	Malan Overgrowth Syndrome	UNIPROT_DG	20673863, 22301465, 26193383, 26200704		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malan overgrowth syndrome	Malan Overgrowth Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malan overgrowth syndrome	Malan Overgrowth Syndrome	BEFREE	25118028, 25345081, 25736188, 26193383, 29184170, 29897170, 30548146, 31369202, 31574590		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31843555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19337254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31843555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	22925353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	24924640, 30548146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marshall-Smith syndrome	Marshall-Smith Syndrome	ORPHANET_DG	20673863		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marshall-Smith syndrome	Marshall-Smith Syndrome	GENOMICS_ENGLAND_DG	20673863, 25118028		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marshall-Smith syndrome	Marshall-Smith Syndrome	CLINVAR_DG	20673863, 25118028, 26200704		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marshall-Smith syndrome	Marshall-Smith Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marshall-Smith syndrome	Marshall-Smith Syndrome	BEFREE	24924640, 26193383, 26200704, 30548146		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marshall-Smith syndrome	Marshall-Smith Syndrome	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Medulloblastoma	Medulloblastoma	Pubtator	36849558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16461008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10318786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	28644838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	2491777, 28644838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35791460	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29899543, 36448712, 36495291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pachygyria	Pachygyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial agenesis of corpus callosum	Partial Agenesis Of Corpus Callosum	BEFREE	17353270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Plagiocephaly	Plagiocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31843555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scaphycephaly	Scaphocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	BEFREE	24443315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	20673863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	31574590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sotos Syndrome	Sotos syndrome	Pubtator	20673863, 29184170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26653554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30418046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Strabismus	Strabismus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Synophrys	Synophrys	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11037881		★★★★★ ★☆☆☆☆ Found in Text Mining only

NFIX (nuclear factor I X)