Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4780
Gene name	NFE2 like bZIP transcription factor 2
Gene symbol	NFE2L2
Synonyms (NCBI Gene)	HEBP1IMDDHHNRF2Nrf-2
Chromosome	2
Chromosome location	2q31.2
Summary	This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these gene

Show/Hide all (8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057519920	C>A,G,T	Likely-pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs1057519921	T>C	Likely-pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs1057519922	C>G,T	Likely-pathogenic, pathogenic	Synonymous variant, missense variant, coding sequence variant, intron variant
rs1057519923	T>A	Likely-pathogenic	Missense variant, coding sequence variant, stop gained, intron variant
rs1057519924	C>A	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs1553487942	C>T	Pathogenic	Intron variant, synonymous variant, coding sequence variant, missense variant
rs1553487947	G>T	Pathogenic	Intron variant, coding sequence variant, missense variant
rs1553488015	C>T	Pathogenic, likely-pathogenic	5 prime UTR variant, coding sequence variant, missense variant

445

Show/Hide all (445)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007310	hsa-miR-144-3p	Luciferase reporter assay	23236440
MIRT007310	hsa-miR-144-3p	Luciferase reporter assay	23236440
MIRT007311	hsa-miR-153-3p	Luciferase reporter assay	23236440
MIRT007312	hsa-miR-142-5p	Luciferase reporter assay	23236440
MIRT007313	hsa-miR-27a-3p	Luciferase reporter assay	23236440
MIRT028764	hsa-miR-26b-5p	Microarray	19088304
MIRT038563	hsa-miR-106b-3p	CLASH	23622248
MIRT440118	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT007313	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT727087	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT440118	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT007313	hsa-miR-27a-3p	Western blotLuciferase reporter assayChIP-seq	25226451
MIRT007313	hsa-miR-27a-3p	Western blotLuciferase reporter assayChIP-seq	25226451
MIRT007311	hsa-miR-153-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26116522
MIRT007311	hsa-miR-153-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26116522
MIRT007310	hsa-miR-144-3p	Luciferase reporter assayqRT-PCRWestern blot	27508019
MIRT736387	hsa-miR-155-5p	Luciferase reporter assayqRT-PCR	33235064
MIRT1182549	hsa-miR-101	CLIP-seq
MIRT1182550	hsa-miR-129-5p	CLIP-seq
MIRT1182551	hsa-miR-144	CLIP-seq
MIRT1182552	hsa-miR-2355-3p	CLIP-seq
MIRT1182553	hsa-miR-3163	CLIP-seq
MIRT1182554	hsa-miR-340	CLIP-seq
MIRT1182555	hsa-miR-4646-3p	CLIP-seq
MIRT1182549	hsa-miR-101	CLIP-seq
MIRT1182556	hsa-miR-106a	CLIP-seq
MIRT1182557	hsa-miR-106b	CLIP-seq
MIRT1182558	hsa-miR-1202	CLIP-seq
MIRT1182559	hsa-miR-128	CLIP-seq
MIRT1182560	hsa-miR-1284	CLIP-seq
MIRT1182550	hsa-miR-129-5p	CLIP-seq
MIRT1182561	hsa-miR-132	CLIP-seq
MIRT1182562	hsa-miR-140-5p	CLIP-seq
MIRT1182551	hsa-miR-144	CLIP-seq
MIRT1182563	hsa-miR-153	CLIP-seq
MIRT1182564	hsa-miR-17	CLIP-seq
MIRT1182565	hsa-miR-20a	CLIP-seq
MIRT1182566	hsa-miR-20b	CLIP-seq
MIRT1182567	hsa-miR-212	CLIP-seq
MIRT1182552	hsa-miR-2355-3p	CLIP-seq
MIRT1182568	hsa-miR-23a	CLIP-seq
MIRT1182569	hsa-miR-23b	CLIP-seq
MIRT1182570	hsa-miR-23c	CLIP-seq
MIRT1182571	hsa-miR-27a	CLIP-seq
MIRT1182572	hsa-miR-27b	CLIP-seq
MIRT1182573	hsa-miR-28-5p	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182575	hsa-miR-3139	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182553	hsa-miR-3163	CLIP-seq
MIRT1182554	hsa-miR-340	CLIP-seq
MIRT1182578	hsa-miR-3545-5p	CLIP-seq
MIRT1182579	hsa-miR-3609	CLIP-seq
MIRT1182580	hsa-miR-3613-3p	CLIP-seq
MIRT1182581	hsa-miR-369-3p	CLIP-seq
MIRT1182582	hsa-miR-374a	CLIP-seq
MIRT1182583	hsa-miR-374b	CLIP-seq
MIRT1182584	hsa-miR-376c	CLIP-seq
MIRT1182585	hsa-miR-3923	CLIP-seq
MIRT1182586	hsa-miR-3941	CLIP-seq
MIRT1182587	hsa-miR-3972	CLIP-seq
MIRT1182588	hsa-miR-3974	CLIP-seq
MIRT1182589	hsa-miR-421	CLIP-seq
MIRT1182590	hsa-miR-4272	CLIP-seq
MIRT1182591	hsa-miR-4460	CLIP-seq
MIRT1182592	hsa-miR-448	CLIP-seq
MIRT1182593	hsa-miR-450b-5p	CLIP-seq
MIRT1182555	hsa-miR-4646-3p	CLIP-seq
MIRT1182594	hsa-miR-466	CLIP-seq
MIRT1182595	hsa-miR-4661-5p	CLIP-seq
MIRT1182596	hsa-miR-4662a-5p	CLIP-seq
MIRT1182597	hsa-miR-4672	CLIP-seq
MIRT1182598	hsa-miR-4676-5p	CLIP-seq
MIRT1182599	hsa-miR-4738-3p	CLIP-seq
MIRT1182600	hsa-miR-4762-5p	CLIP-seq
MIRT1182601	hsa-miR-4776-3p	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182603	hsa-miR-4796-3p	CLIP-seq
MIRT1182604	hsa-miR-499-3p	CLIP-seq
MIRT1182605	hsa-miR-499a-3p	CLIP-seq
MIRT1182606	hsa-miR-507	CLIP-seq
MIRT1182607	hsa-miR-519d	CLIP-seq
MIRT1182608	hsa-miR-522	CLIP-seq
MIRT1182609	hsa-miR-548a-5p	CLIP-seq
MIRT1182610	hsa-miR-548ab	CLIP-seq
MIRT1182611	hsa-miR-548ae	CLIP-seq
MIRT1182612	hsa-miR-548ah	CLIP-seq
MIRT1182613	hsa-miR-548aj	CLIP-seq
MIRT1182614	hsa-miR-548ak	CLIP-seq
MIRT1182615	hsa-miR-548am	CLIP-seq
MIRT1182616	hsa-miR-548b-5p	CLIP-seq
MIRT1182617	hsa-miR-548c-5p	CLIP-seq
MIRT1182618	hsa-miR-548d-5p	CLIP-seq
MIRT1182619	hsa-miR-548h	CLIP-seq
MIRT1182620	hsa-miR-548i	CLIP-seq
MIRT1182621	hsa-miR-548j	CLIP-seq
MIRT1182622	hsa-miR-548k	CLIP-seq
MIRT1182623	hsa-miR-548l	CLIP-seq
MIRT1182624	hsa-miR-548n	CLIP-seq
MIRT1182625	hsa-miR-548w	CLIP-seq
MIRT1182626	hsa-miR-548x	CLIP-seq
MIRT1182627	hsa-miR-548y	CLIP-seq
MIRT1182628	hsa-miR-556-5p	CLIP-seq
MIRT1182629	hsa-miR-557	CLIP-seq
MIRT1182630	hsa-miR-559	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182632	hsa-miR-575	CLIP-seq
MIRT1182633	hsa-miR-582-5p	CLIP-seq
MIRT1182634	hsa-miR-606	CLIP-seq
MIRT1182635	hsa-miR-610	CLIP-seq
MIRT1182636	hsa-miR-633	CLIP-seq
MIRT1182637	hsa-miR-676	CLIP-seq
MIRT1182638	hsa-miR-708	CLIP-seq
MIRT1182639	hsa-miR-889	CLIP-seq
MIRT1182640	hsa-miR-93	CLIP-seq
MIRT1182560	hsa-miR-1284	CLIP-seq
MIRT1182563	hsa-miR-153	CLIP-seq
MIRT1182585	hsa-miR-3923	CLIP-seq
MIRT1182592	hsa-miR-448	CLIP-seq
MIRT1182593	hsa-miR-450b-5p	CLIP-seq
MIRT1182606	hsa-miR-507	CLIP-seq
MIRT1182629	hsa-miR-557	CLIP-seq
MIRT1182558	hsa-miR-1202	CLIP-seq
MIRT1182559	hsa-miR-128	CLIP-seq
MIRT1182560	hsa-miR-1284	CLIP-seq
MIRT1182550	hsa-miR-129-5p	CLIP-seq
MIRT1182563	hsa-miR-153	CLIP-seq
MIRT1182568	hsa-miR-23a	CLIP-seq
MIRT1182569	hsa-miR-23b	CLIP-seq
MIRT1182570	hsa-miR-23c	CLIP-seq
MIRT1182571	hsa-miR-27a	CLIP-seq
MIRT1182572	hsa-miR-27b	CLIP-seq
MIRT1182573	hsa-miR-28-5p	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182575	hsa-miR-3139	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182554	hsa-miR-340	CLIP-seq
MIRT1182581	hsa-miR-369-3p	CLIP-seq
MIRT1182582	hsa-miR-374a	CLIP-seq
MIRT1182583	hsa-miR-374b	CLIP-seq
MIRT1182585	hsa-miR-3923	CLIP-seq
MIRT1182587	hsa-miR-3972	CLIP-seq
MIRT1182592	hsa-miR-448	CLIP-seq
MIRT1182593	hsa-miR-450b-5p	CLIP-seq
MIRT1182601	hsa-miR-4776-3p	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182604	hsa-miR-499-3p	CLIP-seq
MIRT1182605	hsa-miR-499a-3p	CLIP-seq
MIRT1182606	hsa-miR-507	CLIP-seq
MIRT1182609	hsa-miR-548a-5p	CLIP-seq
MIRT1182610	hsa-miR-548ab	CLIP-seq
MIRT1182614	hsa-miR-548ak	CLIP-seq
MIRT1182616	hsa-miR-548b-5p	CLIP-seq
MIRT1182617	hsa-miR-548c-5p	CLIP-seq
MIRT1182618	hsa-miR-548d-5p	CLIP-seq
MIRT1182619	hsa-miR-548h	CLIP-seq
MIRT1182620	hsa-miR-548i	CLIP-seq
MIRT1182621	hsa-miR-548j	CLIP-seq
MIRT1182622	hsa-miR-548k	CLIP-seq
MIRT1182623	hsa-miR-548l	CLIP-seq
MIRT1182625	hsa-miR-548w	CLIP-seq
MIRT1182627	hsa-miR-548y	CLIP-seq
MIRT1182628	hsa-miR-556-5p	CLIP-seq
MIRT1182629	hsa-miR-557	CLIP-seq
MIRT1182630	hsa-miR-559	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182635	hsa-miR-610	CLIP-seq
MIRT1182638	hsa-miR-708	CLIP-seq
MIRT1182559	hsa-miR-128	CLIP-seq
MIRT1182560	hsa-miR-1284	CLIP-seq
MIRT1182550	hsa-miR-129-5p	CLIP-seq
MIRT1182561	hsa-miR-132	CLIP-seq
MIRT1182563	hsa-miR-153	CLIP-seq
MIRT1182567	hsa-miR-212	CLIP-seq
MIRT1182568	hsa-miR-23a	CLIP-seq
MIRT1182569	hsa-miR-23b	CLIP-seq
MIRT1182570	hsa-miR-23c	CLIP-seq
MIRT1182571	hsa-miR-27a	CLIP-seq
MIRT1182572	hsa-miR-27b	CLIP-seq
MIRT1182573	hsa-miR-28-5p	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182575	hsa-miR-3139	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182554	hsa-miR-340	CLIP-seq
MIRT1182581	hsa-miR-369-3p	CLIP-seq
MIRT1182582	hsa-miR-374a	CLIP-seq
MIRT1182583	hsa-miR-374b	CLIP-seq
MIRT1182585	hsa-miR-3923	CLIP-seq
MIRT1182586	hsa-miR-3941	CLIP-seq
MIRT1182589	hsa-miR-421	CLIP-seq
MIRT1182590	hsa-miR-4272	CLIP-seq
MIRT1182592	hsa-miR-448	CLIP-seq
MIRT1182593	hsa-miR-450b-5p	CLIP-seq
MIRT1182594	hsa-miR-466	CLIP-seq
MIRT1182596	hsa-miR-4662a-5p	CLIP-seq
MIRT1182597	hsa-miR-4672	CLIP-seq
MIRT1182598	hsa-miR-4676-5p	CLIP-seq
MIRT2282184	hsa-miR-4699-3p	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182604	hsa-miR-499-3p	CLIP-seq
MIRT1182605	hsa-miR-499a-3p	CLIP-seq
MIRT2282185	hsa-miR-500a	CLIP-seq
MIRT2282186	hsa-miR-501-5p	CLIP-seq
MIRT1182606	hsa-miR-507	CLIP-seq
MIRT1182608	hsa-miR-522	CLIP-seq
MIRT1182609	hsa-miR-548a-5p	CLIP-seq
MIRT1182610	hsa-miR-548ab	CLIP-seq
MIRT1182614	hsa-miR-548ak	CLIP-seq
MIRT1182616	hsa-miR-548b-5p	CLIP-seq
MIRT1182617	hsa-miR-548c-5p	CLIP-seq
MIRT1182618	hsa-miR-548d-5p	CLIP-seq
MIRT1182619	hsa-miR-548h	CLIP-seq
MIRT1182620	hsa-miR-548i	CLIP-seq
MIRT1182621	hsa-miR-548j	CLIP-seq
MIRT1182622	hsa-miR-548k	CLIP-seq
MIRT1182623	hsa-miR-548l	CLIP-seq
MIRT1182625	hsa-miR-548w	CLIP-seq
MIRT1182627	hsa-miR-548y	CLIP-seq
MIRT1182628	hsa-miR-556-5p	CLIP-seq
MIRT1182629	hsa-miR-557	CLIP-seq
MIRT1182630	hsa-miR-559	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182632	hsa-miR-575	CLIP-seq
MIRT1182633	hsa-miR-582-5p	CLIP-seq
MIRT1182636	hsa-miR-633	CLIP-seq
MIRT2282187	hsa-miR-634	CLIP-seq
MIRT1182637	hsa-miR-676	CLIP-seq
MIRT1182638	hsa-miR-708	CLIP-seq
MIRT1182560	hsa-miR-1284	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182585	hsa-miR-3923	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182549	hsa-miR-101	CLIP-seq
MIRT1182559	hsa-miR-128	CLIP-seq
MIRT1182550	hsa-miR-129-5p	CLIP-seq
MIRT1182562	hsa-miR-140-5p	CLIP-seq
MIRT1182551	hsa-miR-144	CLIP-seq
MIRT1182563	hsa-miR-153	CLIP-seq
MIRT1182552	hsa-miR-2355-3p	CLIP-seq
MIRT1182568	hsa-miR-23a	CLIP-seq
MIRT1182569	hsa-miR-23b	CLIP-seq
MIRT1182570	hsa-miR-23c	CLIP-seq
MIRT1182571	hsa-miR-27a	CLIP-seq
MIRT1182572	hsa-miR-27b	CLIP-seq
MIRT1182573	hsa-miR-28-5p	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182575	hsa-miR-3139	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182553	hsa-miR-3163	CLIP-seq
MIRT1182554	hsa-miR-340	CLIP-seq
MIRT1182578	hsa-miR-3545-5p	CLIP-seq
MIRT1182581	hsa-miR-369-3p	CLIP-seq
MIRT1182582	hsa-miR-374a	CLIP-seq
MIRT1182583	hsa-miR-374b	CLIP-seq
MIRT1182584	hsa-miR-376c	CLIP-seq
MIRT1182586	hsa-miR-3941	CLIP-seq
MIRT1182591	hsa-miR-4460	CLIP-seq
MIRT1182592	hsa-miR-448	CLIP-seq
MIRT1182593	hsa-miR-450b-5p	CLIP-seq
MIRT1182555	hsa-miR-4646-3p	CLIP-seq
MIRT1182594	hsa-miR-466	CLIP-seq
MIRT1182596	hsa-miR-4662a-5p	CLIP-seq
MIRT1182597	hsa-miR-4672	CLIP-seq
MIRT1182598	hsa-miR-4676-5p	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182604	hsa-miR-499-3p	CLIP-seq
MIRT1182605	hsa-miR-499a-3p	CLIP-seq
MIRT1182606	hsa-miR-507	CLIP-seq
MIRT1182608	hsa-miR-522	CLIP-seq
MIRT1182609	hsa-miR-548a-5p	CLIP-seq
MIRT1182610	hsa-miR-548ab	CLIP-seq
MIRT1182614	hsa-miR-548ak	CLIP-seq
MIRT1182616	hsa-miR-548b-5p	CLIP-seq
MIRT1182617	hsa-miR-548c-5p	CLIP-seq
MIRT1182618	hsa-miR-548d-5p	CLIP-seq
MIRT1182619	hsa-miR-548h	CLIP-seq
MIRT1182620	hsa-miR-548i	CLIP-seq
MIRT1182621	hsa-miR-548j	CLIP-seq
MIRT1182622	hsa-miR-548k	CLIP-seq
MIRT1182623	hsa-miR-548l	CLIP-seq
MIRT1182625	hsa-miR-548w	CLIP-seq
MIRT1182627	hsa-miR-548y	CLIP-seq
MIRT1182628	hsa-miR-556-5p	CLIP-seq
MIRT1182629	hsa-miR-557	CLIP-seq
MIRT1182630	hsa-miR-559	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182632	hsa-miR-575	CLIP-seq
MIRT1182633	hsa-miR-582-5p	CLIP-seq
MIRT1182635	hsa-miR-610	CLIP-seq
MIRT1182637	hsa-miR-676	CLIP-seq
MIRT1182638	hsa-miR-708	CLIP-seq
MIRT1182639	hsa-miR-889	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182586	hsa-miR-3941	CLIP-seq
MIRT1182594	hsa-miR-466	CLIP-seq
MIRT1182597	hsa-miR-4672	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182608	hsa-miR-522	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182556	hsa-miR-106a	CLIP-seq
MIRT1182557	hsa-miR-106b	CLIP-seq
MIRT1182559	hsa-miR-128	CLIP-seq
MIRT1182560	hsa-miR-1284	CLIP-seq
MIRT1182563	hsa-miR-153	CLIP-seq
MIRT1182564	hsa-miR-17	CLIP-seq
MIRT1182565	hsa-miR-20a	CLIP-seq
MIRT1182566	hsa-miR-20b	CLIP-seq
MIRT1182568	hsa-miR-23a	CLIP-seq
MIRT1182569	hsa-miR-23b	CLIP-seq
MIRT1182570	hsa-miR-23c	CLIP-seq
MIRT1182571	hsa-miR-27a	CLIP-seq
MIRT1182572	hsa-miR-27b	CLIP-seq
MIRT1182573	hsa-miR-28-5p	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182575	hsa-miR-3139	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182554	hsa-miR-340	CLIP-seq
MIRT1182579	hsa-miR-3609	CLIP-seq
MIRT1182580	hsa-miR-3613-3p	CLIP-seq
MIRT1182581	hsa-miR-369-3p	CLIP-seq
MIRT1182582	hsa-miR-374a	CLIP-seq
MIRT1182583	hsa-miR-374b	CLIP-seq
MIRT1182585	hsa-miR-3923	CLIP-seq
MIRT1182586	hsa-miR-3941	CLIP-seq
MIRT1182589	hsa-miR-421	CLIP-seq
MIRT1182590	hsa-miR-4272	CLIP-seq
MIRT1182592	hsa-miR-448	CLIP-seq
MIRT1182593	hsa-miR-450b-5p	CLIP-seq
MIRT1182594	hsa-miR-466	CLIP-seq
MIRT1182595	hsa-miR-4661-5p	CLIP-seq
MIRT1182597	hsa-miR-4672	CLIP-seq
MIRT1182599	hsa-miR-4738-3p	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182603	hsa-miR-4796-3p	CLIP-seq
MIRT1182604	hsa-miR-499-3p	CLIP-seq
MIRT1182605	hsa-miR-499a-3p	CLIP-seq
MIRT1182606	hsa-miR-507	CLIP-seq
MIRT1182607	hsa-miR-519d	CLIP-seq
MIRT1182608	hsa-miR-522	CLIP-seq
MIRT1182609	hsa-miR-548a-5p	CLIP-seq
MIRT1182610	hsa-miR-548ab	CLIP-seq
MIRT1182611	hsa-miR-548ae	CLIP-seq
MIRT1182612	hsa-miR-548ah	CLIP-seq
MIRT1182613	hsa-miR-548aj	CLIP-seq
MIRT1182614	hsa-miR-548ak	CLIP-seq
MIRT1182615	hsa-miR-548am	CLIP-seq
MIRT1182616	hsa-miR-548b-5p	CLIP-seq
MIRT1182617	hsa-miR-548c-5p	CLIP-seq
MIRT1182618	hsa-miR-548d-5p	CLIP-seq
MIRT1182619	hsa-miR-548h	CLIP-seq
MIRT1182620	hsa-miR-548i	CLIP-seq
MIRT1182621	hsa-miR-548j	CLIP-seq
MIRT1182622	hsa-miR-548k	CLIP-seq
MIRT1182623	hsa-miR-548l	CLIP-seq
MIRT1182625	hsa-miR-548w	CLIP-seq
MIRT1182626	hsa-miR-548x	CLIP-seq
MIRT1182627	hsa-miR-548y	CLIP-seq
MIRT1182628	hsa-miR-556-5p	CLIP-seq
MIRT1182629	hsa-miR-557	CLIP-seq
MIRT1182630	hsa-miR-559	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182633	hsa-miR-582-5p	CLIP-seq
MIRT1182634	hsa-miR-606	CLIP-seq
MIRT1182636	hsa-miR-633	CLIP-seq
MIRT1182637	hsa-miR-676	CLIP-seq
MIRT1182638	hsa-miR-708	CLIP-seq
MIRT1182640	hsa-miR-93	CLIP-seq
MIRT1182556	hsa-miR-106a	CLIP-seq
MIRT1182557	hsa-miR-106b	CLIP-seq
MIRT1182559	hsa-miR-128	CLIP-seq
MIRT1182560	hsa-miR-1284	CLIP-seq
MIRT1182563	hsa-miR-153	CLIP-seq
MIRT1182564	hsa-miR-17	CLIP-seq
MIRT1182565	hsa-miR-20a	CLIP-seq
MIRT1182566	hsa-miR-20b	CLIP-seq
MIRT1182568	hsa-miR-23a	CLIP-seq
MIRT1182569	hsa-miR-23b	CLIP-seq
MIRT1182570	hsa-miR-23c	CLIP-seq
MIRT1182571	hsa-miR-27a	CLIP-seq
MIRT1182572	hsa-miR-27b	CLIP-seq
MIRT1182573	hsa-miR-28-5p	CLIP-seq
MIRT1182574	hsa-miR-3117-5p	CLIP-seq
MIRT1182575	hsa-miR-3139	CLIP-seq
MIRT1182576	hsa-miR-3140-3p	CLIP-seq
MIRT1182577	hsa-miR-3145-5p	CLIP-seq
MIRT1182554	hsa-miR-340	CLIP-seq
MIRT1182579	hsa-miR-3609	CLIP-seq
MIRT1182580	hsa-miR-3613-3p	CLIP-seq
MIRT1182581	hsa-miR-369-3p	CLIP-seq
MIRT1182582	hsa-miR-374a	CLIP-seq
MIRT1182583	hsa-miR-374b	CLIP-seq
MIRT1182585	hsa-miR-3923	CLIP-seq
MIRT1182586	hsa-miR-3941	CLIP-seq
MIRT1182589	hsa-miR-421	CLIP-seq
MIRT1182590	hsa-miR-4272	CLIP-seq
MIRT1182592	hsa-miR-448	CLIP-seq
MIRT1182593	hsa-miR-450b-5p	CLIP-seq
MIRT1182594	hsa-miR-466	CLIP-seq
MIRT1182597	hsa-miR-4672	CLIP-seq
MIRT1182599	hsa-miR-4738-3p	CLIP-seq
MIRT1182602	hsa-miR-4795-3p	CLIP-seq
MIRT1182603	hsa-miR-4796-3p	CLIP-seq
MIRT1182604	hsa-miR-499-3p	CLIP-seq
MIRT1182605	hsa-miR-499a-3p	CLIP-seq
MIRT1182606	hsa-miR-507	CLIP-seq
MIRT1182607	hsa-miR-519d	CLIP-seq
MIRT1182608	hsa-miR-522	CLIP-seq
MIRT1182609	hsa-miR-548a-5p	CLIP-seq
MIRT1182610	hsa-miR-548ab	CLIP-seq
MIRT1182611	hsa-miR-548ae	CLIP-seq
MIRT1182612	hsa-miR-548ah	CLIP-seq
MIRT1182613	hsa-miR-548aj	CLIP-seq
MIRT1182614	hsa-miR-548ak	CLIP-seq
MIRT1182615	hsa-miR-548am	CLIP-seq
MIRT1182616	hsa-miR-548b-5p	CLIP-seq
MIRT1182617	hsa-miR-548c-5p	CLIP-seq
MIRT1182618	hsa-miR-548d-5p	CLIP-seq
MIRT1182619	hsa-miR-548h	CLIP-seq
MIRT1182620	hsa-miR-548i	CLIP-seq
MIRT1182621	hsa-miR-548j	CLIP-seq
MIRT1182622	hsa-miR-548k	CLIP-seq
MIRT1182623	hsa-miR-548l	CLIP-seq
MIRT1182625	hsa-miR-548w	CLIP-seq
MIRT1182626	hsa-miR-548x	CLIP-seq
MIRT1182627	hsa-miR-548y	CLIP-seq
MIRT1182628	hsa-miR-556-5p	CLIP-seq
MIRT1182629	hsa-miR-557	CLIP-seq
MIRT1182630	hsa-miR-559	CLIP-seq
MIRT1182631	hsa-miR-561	CLIP-seq
MIRT1182633	hsa-miR-582-5p	CLIP-seq
MIRT1182634	hsa-miR-606	CLIP-seq
MIRT1182636	hsa-miR-633	CLIP-seq
MIRT1182637	hsa-miR-676	CLIP-seq
MIRT1182638	hsa-miR-708	CLIP-seq
MIRT1182640	hsa-miR-93	CLIP-seq

116

Show/Hide all (116)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17015834, 20452972
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	TAS	24252804
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	17015834
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	22492997
GO:0002931	Process	Response to ischemia	IEA
GO:0003677	Function	DNA binding	IDA	18554677
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	20452972
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7937919
GO:0005515	Function	Protein binding	IPI	15601839, 16888629, 17015834, 18048326, 18692475, 18757741, 19706542, 21597468, 21988832, 23661758, 25416956, 25684205, 26700459, 28777872, 29792731, 29983246, 31169361, 31262713, 31515488, 32296183, 32911434, 33961781, 34591642, 35512704, 36442525, 37187359, 38891776, 39009827
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15601839, 18202225, 18554677, 22492997, 23043106
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15601839, 22492997
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA	23043106
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758
GO:0006954	Process	Inflammatory response	IEA
GO:0006979	Process	Response to oxidative stress	IDA	36075446
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IDA	19424503
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	27155659
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016567	Process	Protein ubiquitination	IDA	15983046
GO:0016592	Component	Mediator complex	EXP	32727915
GO:0019904	Function	Protein domain specific binding	IPI	11256947
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24366543
GO:0032993	Component	Protein-DNA complex	IEA
GO:0032993	Component	Protein-DNA complex	ISS
GO:0034599	Process	Cellular response to oxidative stress	IBA
GO:0034599	Process	Cellular response to oxidative stress	IDA	36075446
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0034599	Process	Cellular response to oxidative stress	NAS	22013210
GO:0034599	Process	Cellular response to oxidative stress	TAS	22934019
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0036499	Process	PERK-mediated unfolded protein response	IEA
GO:0036499	Process	PERK-mediated unfolded protein response	ISS
GO:0036499	Process	PERK-mediated unfolded protein response	TAS	22934019
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15983046
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	20452972
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045088	Process	Regulation of innate immune response	IEA
GO:0045088	Process	Regulation of innate immune response	ISS
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	IMP	29018201
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	32727915
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17015834
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18202225, 22492997, 23043106, 24844779, 25190803
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0046223	Process	Aflatoxin catabolic process	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0061431	Process	Cellular response to methionine	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	23043106
GO:0061771	Process	Response to caloric restriction	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IGI	22492997
GO:0070301	Process	Cellular response to hydrogen peroxide	IMP	23043106
GO:0071280	Process	Cellular response to copper ion	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IMP	18202225
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	IMP	24844779
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IDA	25190803
GO:0071499	Process	Cellular response to laminar fluid shear stress	IMP	23043106
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758
GO:0110076	Process	Negative regulation of ferroptosis	IMP	26403645
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:0140693	Function	Molecular condensate scaffold activity	IDA	32727915
GO:1900038	Process	Negative regulation of cellular response to hypoxia	IEA
GO:1900407	Process	Regulation of cellular response to oxidative stress	EXP	34299054
GO:1902037	Process	Negative regulation of hematopoietic stem cell differentiation	IEA
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IMP	23043106
GO:1903788	Process	Positive regulation of glutathione biosynthetic process	IEA
GO:1904294	Process	Positive regulation of ERAD pathway	TAS	23800989
GO:1904385	Process	Cellular response to angiotensin	IEA
GO:1904753	Process	Negative regulation of vascular associated smooth muscle cell migration	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	TAS	23800989
GO:2000121	Process	Regulation of removal of superoxide radicals	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	23043106
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
600492	7782	ENSG00000116044

Q16236

Protein name

Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nrf-2) (Nuclear factor, erythroid derived 2, like 2)

Protein function

Transcription factor that plays a key role in the response to oxidative stress: binds to antioxidant response (ARE) elements present in the promoter region of many cytoprotective genes, such as phase 2 detoxifying enzymes, and promotes their exp

PDB

2FLU , 2LZ1 , 3ZGC , 4IFL , 5WFV , 6T7V , 7K28 , 7K29 , 7K2A , 7K2B , 7K2C , 7K2D , 7K2E , 7K2K , 7O7B , 7X5E , 7X5F , 7X5G , 8EJR , 8EJS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03131	bZIP_Maf	468 → 561	bZIP Maf transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle. {ECO:0000269|PubMed:7937919}.

Sequence

MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN

Sequence length

605

Interactions

View interactions

	KEGG
	Protein processing in endoplasmic reticulum Parkinson disease Pathways in cancer Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Lipid and atherosclerosis Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Colorectal cancer	Likely pathogenic; Pathogenic	rs1553488015	RCV000626453	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency, developmental delay, and hypohomocysteinemia	Pathogenic; Likely pathogenic	rs1057519922, rs1553487947, rs1553487942, rs1553488015	RCV000513666 RCV000513667 RCV000513668 RCV000513670	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lung cancer	Likely pathogenic	rs2105458487	RCV001807877	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (67)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SICKLE CELL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOGENESIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, PANCREATIC DUCTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DELAY, IMMUNODEFICIENCY, LEUKOENCEPHALOPATHY, HYPOHOMOCYSTEINEMIA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DELAY-IMMUNODEFICIENCY-LEUKOENCEPHALOPATHY-HYPOHOMOCYSTEINEMIA SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOCRINE SYSTEM DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC INSUFFICIENCY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental abnormality	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NFE2L2-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR SYSTEM INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (764)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	23722164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	29046485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	24958931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25323587, 28505160, 30623427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29854090, 29870787, 30174606, 30798137, 31127077, 31781326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15657364, 25003661, 29597191, 31032633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20347035, 20534738, 21489257, 24040073, 27567474, 28049629, 28849259, 30333878, 31628914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20347035, 24040073, 26078725, 26385919, 26923328, 28104435, 28604754, 28967920, 29050246, 29486183, 29526543, 30333878, 30411339, 30556750, 30756407 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18074351, 30597358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18074351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18074351, 26588861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26471626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33101586, 35467062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	29947925, 29997171, 30165058, 31340446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30112024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24440594, 28103505, 28253482, 29186981, 30216854, 30253279, 30455645, 31271759, 31601909, 31752195, 31781321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	35467062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	22693571, 22855800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28685843, 29636694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	28685843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	28685843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	23570914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17204939, 23864927, 28349780, 30068908, 31175839, 33605427, 33633844, 34837964, 36035216, 36065437, 37511065, 40363853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22077634	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28448946, 30919246, 30968880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24702189, 28098243, 28421738, 29634349, 30235892, 30946834, 31503421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15870071, 18957896, 19074031, 22353756, 23418589, 23732987, 24102512, 24672634, 24682253, 25280871, 25822630, 27012417, 27439389, 28334913, 29969760 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	24672634	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	19074031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22703534, 30317545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	28685843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	20709907, 30060095, 30755497, 31243572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	30755497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	27071063, 30412705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	30060095	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	20709907, 21483798, 26914345, 28899203, 29046485, 29255069, 30060095, 30412705, 30674214, 31015205, 31404577, 31408727		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Sickle Cell	Anemia	CTD_human_DG	29255069		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	BEFREE	30135655		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26915435, 27167341, 27750041, 29232549, 30302023, 31243599, 31609478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	37852325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	22529290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26733011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26733011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	32273946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29743974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	30025621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15917255, 16246346, 17673673, 19799917, 23043106, 24790085, 26054672, 26510581, 27696667, 27923281, 28189649, 29187515, 29287777, 29917052, 30108504 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29233793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11429414, 35432723, 35759235, 36814154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33426091, 36574898	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	28068647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28408162, 30301214, 31710683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	31830562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	26823733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	26823733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20805158, 21051083, 21514635, 21799075, 22634146, 23622008, 24783956, 26369337, 27847240, 28273344, 28624471, 30092299, 30312763, 30729848, 31100413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21514635, 21799075, 26344081, 33382170, 35278062, 35572500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31391381	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29441509, 30959808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	37371062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	27636396, 31107893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	31107893		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATAXIA, EARLY-ONSET, WITH OCULOMOTOR APRAXIA AND HYPOALBUMINEMIA	Ataxia-oculomotor apraxia	BEFREE	25976310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15917255, 16246346, 17673673, 19799917, 23043106, 24790085, 26054672, 26510581, 27696667, 27923281, 28189649, 29187515, 29287777, 29917052, 30108504 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15917255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15917255, 16339837, 17673673, 24790085, 34951407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	29205354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30120881, 36980990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34517051	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30120881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30790585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	34517051, 36980990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29034470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15032691, 19799917, 28507037, 29312359, 30625116, 31345729, 31446053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	38062233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29297235, 29538305, 29658582, 29697268, 30055129, 30233707, 30569096, 30605065, 30623427, 30664159, 30890112, 31250159, 31441362, 31599449, 31717324		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	29709906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22503981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33887608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	29214257, 30205995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	27187376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31412319		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	31276102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral hydronephrosis	Hydronephrosis	BEFREE	28233855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	30026087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	18692501, 31590928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	31590928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30386243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	30140361, 31316719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20810543, 23259779, 24837013, 29248722, 30241031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	29864937, 30105924, 31352786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30012915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	38065271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	37393640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	31574956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	36506933, 37098490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	27530814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	34336095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18981988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	27187376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	18981988, 27187376, 30942197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	31298161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17726138, 17822677, 17875699, 19638449, 19940992, 20623181, 21926171, 22387177, 22964583, 23492819, 24302665, 24366869, 24486718, 24491031, 25071010 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21489257, 21926171, 23172368, 23347118, 23875900, 24366869, 25154499, 25226504, 25467193, 25717032, 25827424, 25976679, 27088857, 27713154, 27770790 View all (22 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21799005	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	31298161, 31561304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	30471087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25518008, 27864288, 28667068, 28886148, 29368550, 30024305, 30728889, 31713992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	25518008, 33552042, 37060021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	26962150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31316111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	38063237	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21228930, 21990354, 23710289, 23947958, 25502816, 25505069, 25841766, 25995248, 26226105, 26247201, 26350055, 26385919, 26497117, 28261610, 28330870 View all (16 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoid Tumor	Carcinoid tumor	Pubtator	31126053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22767273, 23052169, 24086340, 29469959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	26350055, 35524269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27057281, 30064139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21897267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22561517, 23728943, 24203292, 25896253, 26194347, 26583321, 27091842, 27650414, 30057686, 30075149, 31968140, 32774674, 32780006, 33101586, 33290263 View all (18 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	31828882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	37236926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20810543, 23259779, 24837013, 24919441, 29248722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31293646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18006113, 18316592, 18829555, 19321346, 19417020, 19646463, 20421815, 20446773, 20534738, 20689807, 21402146, 21964605, 22614957, 23545629, 23572560 View all (35 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26191276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26497117, 26915435, 27167341, 31243599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32629871	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21228930	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25564569, 28061437, 30896860, 31752777, 32830535, 33101586, 33850477, 33953831, 34949764, 37898101, 38583003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18757741, 20421815, 23451093, 24323028, 24390348, 26503331, 27824809, 28177435, 30058679, 31221127, 31828882, 32036209, 32272498, 32434476, 33219256 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26247201	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	20530669, 24892215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21676886, 22378150, 23404377, 25270772, 28112439, 28129239, 29212168, 29410730, 30166520, 30311581, 31472965, 31616183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	CTD_human_DG	21489257		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	21126175, 25674242, 28132522, 28778483, 28942082, 29353218, 29693453, 30096613, 31173878, 31706979, 31712965, 31726716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35383293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27457280, 28673009, 29147465, 29327811, 29392616, 29408448, 30349977, 30619098, 31270951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19530984, 20837051, 21626108, 25564368, 26974313, 27923281, 28119074, 28189649, 28573503, 29104732, 29113088, 29187515, 29228553, 29427794, 30096613 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23974919, 24790085, 32780748, 36012132, 37116256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	30135571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	23072510	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	29339024, 38063237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	20064547, 28722304, 29399076, 31173182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	24525405, 33274006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	33955515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27734181, 27812888, 28169530, 28419990, 28851669, 28956063, 29103101, 29383122, 29564698, 29750875, 29917204, 30024618, 31283926, 31378909, 31389456, 31494826 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35856366, 37983626, 40681605, 40718775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22575091, 26846360, 27696223, 28169530, 28646795, 29373803, 29383122, 29564698, 29628876, 29688134, 30890934, 31494826, 31540440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	27226772, 31336872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	27226772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21842204, 28261610, 30058679, 31056260, 31136958		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26247201, 28412091, 29763899, 30796317, 31173751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21842204, 28261610, 30058679, 31056260, 31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	23316324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21577322, 24528044, 27015836, 35092379, 36111744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24528044, 25708948, 29518609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	30825315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	30825315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	20977460		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	28553227, 29849889, 30416531, 30691853, 31637886		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis Intrahepatic	Intrahepatic cholestasis	Pubtator	34767876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	30039470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	30026087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic colitis	Colitis	BEFREE	27683801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	33149584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28636290, 30462567, 31181253, 31601682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic interstitial nephritis	Interstitial Nephritis	BEFREE	29126308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22200442, 30070341, 31340563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	22200442, 22874821, 24480117, 25140450, 25585822, 26490557, 26915483, 27696667, 27789056, 28347570, 28494744, 28502971, 28561324, 28821730, 28887058 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18566336, 20534903, 20594977, 21318260, 21320471, 21459041, 21490276, 22005302, 22693272, 23590302, 24298892, 24790085, 26861788, 27555763, 27832175 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18566336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23826097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28333129, 31340446		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28042770, 29750408, 30890934, 31336872, 31411465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27761760, 27887948, 28667908, 29036636, 29083257, 29125494, 29689442, 30461032, 31164420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29630901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	26204833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19327358, 22409325, 23494124, 24311782, 28987717, 29887940, 29891588, 30284461, 30426485, 30683827, 31534619, 31628914, 31825438, 31827675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29941222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19524433, 19734940, 21369766, 22526619, 24289544, 24311782, 24556415, 25226504, 28503853, 28737825, 30166520, 30249028, 30407216, 30473361, 30778200 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19706542, 27143122, 32004978, 33101586, 33838628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19734940, 21278237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22325485, 23455180, 24743738, 24901054, 25712056, 26899729, 27033953, 27636860, 27999449, 28542357, 28621229, 29693091, 29793178, 29808795, 29930754 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22529978, 24695690, 25431258, 27259240, 27323826, 27999449, 30778200, 30988303, 31078780, 31366086, 32323779, 32871287, 33754045, 34443375, 35429118 View all (10 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32992842	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophies	Cone-rod dystrophy	BEFREE	28782506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24528044, 25708948, 29518609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25101151, 28132522, 28373008, 28636290, 29373037, 29495326, 30462567, 30858063, 30864233, 31181253, 31285785, 31556830, 31601682		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	28373008		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28061437, 29983865, 30799949, 30896860, 31186733, 31483924, 31752777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	29209447		★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 2	CORNEAL ENDOTHELIAL DYSTROPHY	BEFREE	28642546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal endothelial dystrophy type 2	Corneal endothelial dystrophy	Pubtator	28642546	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24373961, 29104636, 29849452, 30468811, 31082959, 31332605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24373961, 30995787, 31332605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31340238, 34336095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23701284, 24373961, 29845299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	20064547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	35976433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30061089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33882797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	30880689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18846238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22467641, 31145101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27463229, 28237856, 28259976, 28662306, 28684418, 28933476, 28957964, 29138829, 29339024, 29484338, 29765450, 29878401, 30015238, 30071128, 30176344 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	26115075, 28107678, 30981879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	26895301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30382185, 30642751, 31025223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	26087903, 29096692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27646262, 27801891, 28763303, 30386243, 30399591, 30474696, 30776601, 31164818, 31398773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27242339, 28219650, 28912452, 29731194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36108803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	23564646		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	27871981, 31257541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	24503019, 26061570, 29277538, 30293051, 31079103, 31492195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	30742662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21161163, 21439933, 21861804, 22025779, 22575091, 23050040, 23834171, 24186494, 24740756, 25016074, 25674242, 27274779, 27840317, 28012783, 28343084 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	23974919	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21161163, 21439933, 21861804, 22025779, 22575091, 23050040, 23834171, 24186494, 24740756, 25016074, 25528168, 25674242, 27274779, 27840317, 28012783 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22445099, 25674242, 27274779, 30803422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25383674	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23974919, 25511473, 26204833, 27274779, 27374075, 35365152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26536169	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33096729	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28324005, 28700700, 28842399, 29154192, 30119216, 30359563, 30537423, 30551471, 30625116, 30779107, 31244660, 31427974, 31546235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20524845, 21861804, 23331247, 25046864, 25511473, 26204833, 27274779, 27374075, 27903744, 28642811, 28646795, 28684418, 28700700, 28913364, 29085055 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	25674242, 27457280, 27903744, 28677741, 29080123, 29404371, 30971629, 31009852, 31270951, 31323227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	25674242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	32879654, 33096729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	30783799, 31467925, 34894983	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33565572, 35933424	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20103708, 22025779, 23050040, 24072144, 25046864, 26849944, 27799462, 28009869, 28033563, 28286065, 28373900, 28457936, 28501426, 28512642, 28595780 View all (25 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	20103708		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	21439933, 28353124, 29094308, 30045011, 30536411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	24186494, 25016074, 28012783, 29411009, 29989056, 30606939, 30770549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32473920, 32698791, 36795778, 37713847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30112024, 30755497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29589594, 30594664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	30028071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	33633844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	24440594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	17982693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	29684505		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	20530669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31257541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	19671143, 22163265, 27555763	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Encephalitis	Encephalitis	BEFREE	28747068, 29223100		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	22459801, 26459724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20530669, 21897267, 25994056, 28386373, 30711933, 30908539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	20530669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	26824415, 28638475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	20530669		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21228930, 21897267, 26824415, 30908539	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	28457937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	38062233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	22982045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25774506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23686862, 28412310, 29357320, 29691120, 30402855, 31019649, 31472186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34588521, 37946105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	37946105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	23686862, 26149655		★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	26006105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21676886, 23404377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30454888, 31302408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24028437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26341629, 32012470, 34663841, 36116599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26336083, 26341629, 26873401, 27734031, 27749841, 28760781, 29142225, 29675925, 31287493, 31755241, 32012470, 32398863, 33826001, 34263978, 34663841 View all (5 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esophagitis	BEFREE	29282639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	36070895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	29925776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	26336083, 33826001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	28300788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20677908, 21504366, 24170703, 26120584, 26305715, 27837167, 28298541, 28386616, 28419832, 29309075, 30057681		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	24718268	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	28555106		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	37732511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23592516, 23822105, 26679056, 26919834, 27634173, 27984800, 28189916, 29276215, 29355950, 30180301, 30191499, 30248539, 31035006, 31043271, 31775341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	20518088, 22155056, 23592516, 23793039, 25500203, 26918567, 27477297, 27936457, 28423499, 28434817, 28437886, 28601022, 28665955, 28794616, 28826090 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	23793039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	21376112, 29064158, 31592832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	28211606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	23350650, 28935570, 29057804, 31118567		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	23350650, 23574943, 30065630, 31031004, 31640150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	30954537, 31362587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	22836768, 24030461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	22836768, 24030461, 31857234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	25916679, 31712142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	CTD_human_DG	20404090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	18692501, 30822690		★★★★★ ★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	18692501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32432738, 32839463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	17982693, 28768046, 29203367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	LHGDN	17982693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18097597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	31132430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	33887608	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29282639, 31132430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	17562481		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Diseases	Gastrointestinal Diseases	CTD_human_DG	20404090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroparesis	Gastroparesis	BEFREE	21605664, 30831189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	28170191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized Myotonia of Thomsen	Congenital myotonia	BEFREE	28942193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	23686862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	31468582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	26191170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28081465, 28673001, 30637543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23006842, 23708697, 24078215, 24374745, 25226504, 25304134, 27148686, 28260004, 28424758, 28560379, 29128799, 29662304, 30885764, 31444413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25226504, 25304134, 30353492, 31037147, 32203214, 32617133, 33271924, 35803910, 35962317, 38241776, 40684395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23006842, 23673813, 23708697, 24078215, 24374745, 25226504, 27148686, 28260004, 28424758, 28560379, 29128799, 29662304, 30885764, 31444413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23006842, 23128449, 24374745, 25304134, 25851054, 27000259, 27187376, 28427200, 28685346, 28782555, 28805788, 31444413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25304134, 25851054, 27187376, 28427200, 29414774, 30942197, 32484805, 33101586, 33760110, 33801310, 34815381, 35803910, 36231068, 39248438, 40355831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	28115189, 29254287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	34091451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	30105924, 30208622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	29285131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28170191, 30216854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadotropin-Resistant Ovary Syndrome	Gonadotropin-Resistant Ovary Syndrome	CTD_human_DG	26247513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hair Diseases	Hair Diseases	BEFREE	28685843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31768045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	30560518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21062981, 27544755, 27550943, 27733046, 28012440, 30339884, 31470592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27638861, 33859744, 33916908, 34479919, 35806488, 36139430, 38132173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	34091451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	35035663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22938199, 29050006, 30346043, 31712965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23316324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25101151, 28132522, 28373008, 29495326, 30858063, 30864233, 31556830		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	28373008		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	32620106	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	28373008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	30836997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	27936457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	31276102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	27936457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	Pubtator	21464371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	39510246	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	21868703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31351363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	29458270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24718268, 29940898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24811996	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24811996, 30929321, 37732511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	21097520, 25135868, 27734029, 30287928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	30287928, 32240714, 33125945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	28785378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27713154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	27936457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	31270017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	23365135, 26551707, 29302811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	26551707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	24904228, 26490557, 29151180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Holt-Oram syndrome	Holt-Oram Syndrome	BEFREE	29323103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20338236, 22138129, 23469253, 24904228, 25280871, 26490557, 28533375, 29121340, 29151180, 29323772, 30391672, 30853569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	40336225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	31206177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28834687, 30463003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18633117, 22683333, 25016074, 27497668, 27840317, 28040599, 28098811, 28254022, 28353124, 28758742, 29486138, 29655866, 29719281, 29781726, 29849938 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	18633117, 27542238, 32369110	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	20086057		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypergonadotropic Ovarian Failure, X-Linked	Premature ovarian failure	CTD_human_DG	26247513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29608906, 30105650, 30105954, 30949917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	27939242, 30248482, 31485663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	21177379, 28233855, 30409900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29172017, 30817903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	23738042	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	26465873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	28513870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27226772, 37154169	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	27223823, 27226772, 28842207, 28906458, 28978980, 29167164, 29211853, 30483753, 31251976, 31332605, 31416234		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	31281590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	25807533, 28971839, 30248482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	25807533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	30565690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20197421, 27566589, 34162953, 35417854	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24063008, 30241031, 31078780, 33290263, 33326735, 33441543, 33491566, 35409364, 35833819, 36082356, 36481701, 36709476, 36791645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32978975	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28781627, 30460866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis vulgaris	Pubtator	20664557	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31195886, 31238128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22703534, 27864288, 28420366, 30317545, 30728889, 31611754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28550120, 29050006		★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY, DEVELOPMENTAL DELAY, AND HYPOHOMOCYSTEINEMIA	Immunodeficiency, Developmental Delay, And Hypohomocysteinemia	UNIPROT_DG	29018201		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IMMUNODEFICIENCY, DEVELOPMENTAL DELAY, AND HYPOHOMOCYSTEINEMIA	Immunodeficiency, Developmental Delay, And Hypohomocysteinemia	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22020111, 24702189, 27761760, 27887948, 28667908, 28974442, 29036636, 29083257, 29113796, 29441016, 29474348, 29533123, 29630901, 29684505, 29689442 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	23089668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24311782, 29891588, 30182837, 31434263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	25078150, 28349780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28219650, 28912452, 29731194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26204833, 30273379, 30466006, 32879654, 37768516	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30358118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32320383, 32844924, 38063237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30779107, 31427974, 31546235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	31220996, 31585542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	28365443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31541481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	29205354, 31333462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	27936457, 29135935, 31198069, 31323261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	32278200, 37768516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28132764, 28162056, 28747068, 29338172, 29628876, 30323140, 30890934, 31812555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	25995248, 30787155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	30474788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	30106111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	32555404	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36240204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	27183391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoma	Keratoma	CTD_human_DG	20404090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	CTD_human_DG	20404090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratosis Blennorrhagica	Keratosis Blennorrhagica	CTD_human_DG	20404090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30599261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	20605904		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	23220723, 27804998, 28061437, 28494744, 28502971, 28791341, 29064158, 29211853, 29393366, 29447051, 30248418, 30876865, 31059771, 31279986, 31372933, 31488013 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	28061437, 29959986, 38304428	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	31340563, 32661200, 32871287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	32660150	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	24958931		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	27789056, 28347910, 28494744, 28502971, 28586635, 28685413, 28928081, 29068550, 29104636, 29522116, 30178867, 31037316, 31333462, 31349118, 31471671, 31849693 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	22200442, 30070341, 31340563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30647407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	28061437, 37898101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25631445, 27840932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	28373008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	26787895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18813798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20345481, 32293500, 35840666, 36453238, 36528059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20618971, 21192341, 23820265, 25918581, 27196781, 28032588, 29118925, 30171828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	21099366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18202225, 20345481, 21099366, 23077289, 25003661, 28505160, 30623427, 35840666, 36061350, 36303144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33202543, 36528059	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	29597191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18202225, 21212410, 23077289, 25323587, 28032588, 28505160, 30142422, 30623427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31527445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24086340, 28529569, 31715238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15477009, 16951152, 21482715, 22561517, 23728943, 24203292, 24379610, 25016225, 25058527, 25135868, 25556489, 25783764, 25896253, 26194347, 27091842 View all (38 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	22561517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22459801, 24636985, 28333129, 29852187, 31183386, 31340446, 31386899		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	23793039		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	28665955, 37924785	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	30929321	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28333129	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	26459724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	37732511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	31340446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	29331651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30466006, 33162398, 37924785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29715757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15477009, 16951152, 27734029, 28655791, 30619751, 30940595, 31637886		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	20722399		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Neoplasms	Liver neoplasm	Pubtator	29940898, 34069882, 34985276	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	19027064, 19646463, 22686525, 23590302, 24783956, 28942193, 30610225, 30728889, 31238128		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	26465873, 27591243, 27824809, 29703138, 31947722	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	36574898	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16507366, 17606720, 18316592, 18829555		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	20421815, 20682644, 23947958, 24040073, 24046186, 24928441, 26134408, 26343532, 27347930, 27824809, 28330870, 28349780, 28939896, 28965760, 29089357 View all (27 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	21177379, 25339352, 27847554, 28967920, 29526543, 29634345, 31126053, 31257027		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	30466076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20507872, 30466076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	24025640, 28851669, 31023362, 31311094, 31698204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	38304428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25588809, 29716554, 36951264	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26410168, 28501854, 34264023, 37312528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24915933, 34239803, 37511362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	24675225, 29247688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23276910, 24440594	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	31129156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29119264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25304134, 25851054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27544755, 27550943, 27733046, 28012440, 30339884, 31470592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25896339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17726138, 17822677, 17875699, 19638449, 19940992, 20623181, 21926171, 22387177, 22964583, 23492819, 24302665, 24366869, 24486718, 24491031, 25071010 View all (35 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20530669, 21897267, 25994056, 28386373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29243822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18692501, 22348534, 30822690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28061437, 31372933, 31752777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20722399, 28627706, 28655791, 29223570, 29499281, 30251384, 31097586, 31840883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	20722399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18006113, 18316592, 18829555, 19321346, 19417020, 19646463, 20421815, 20446773, 20534738, 20689807, 21964605, 22249257, 22614957, 23545629, 23572560 View all (36 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24086340, 28529569, 31715238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23404377, 25114896, 25270772, 28112439, 29212168, 29410730, 30166520, 30311581, 31472965, 31616183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20118824, 21489257, 21734707, 24366069, 26117456, 26682003, 26980696, 27167341, 29240881, 29701272, 29765509, 29849873, 30355620, 30355942, 30735911 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	20124447, 23441843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20729872, 21837756, 24121106, 25266896, 25728635, 26227317, 27788496, 28978049, 29228771, 29247555, 29368435, 29383876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	18572023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19967722, 25804610, 28125038, 29603113, 31254216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23933386, 28344324, 29091877, 30504425, 30811526, 31629709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23766517, 24138990, 29901070, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20810543, 23259779, 24837013, 24919441, 29248722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15252150, 15572695, 16054659, 16435293, 16543142, 17015834, 17020408, 17129360, 17606720, 18036733, 18048326, 18692501, 18757741, 18838122, 19050705 View all (238 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	22767273, 29306329, 31628914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21842204, 28261610, 30058679, 31056260, 31136958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19524433, 19734940, 21369766, 22526619, 24289544, 24311782, 24556415, 28503853, 28737825, 30166520, 30249028, 30407216, 30473361, 30778200, 30844440 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Uterine Corpus Neoplasm	Malignant Uterine Corpus Neoplasm	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17726138, 17875699, 19138946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25398768, 25451081, 29729523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	36631900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS	Megalencephalic Leukoencephalopathy With Subcortical Cysts	BEFREE	23729024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	31687076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24260504, 31687076, 33573155, 33684228, 33769711, 33916908, 34951143, 36050469, 38092271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24491031, 27045471, 27170270, 29434949, 29487283, 29670684, 30231594, 31687076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31802848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	32661200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	29501041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	27187376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	27187376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27646262, 27801891, 28763303, 30386243, 30399591, 30474696, 30776601, 31164818, 31398773		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	23686862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22019695, 23187004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	23187004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25896339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	22025779, 28722145, 30352880, 30610225, 31031630, 31396308, 31434263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	31366177, 35365152, 37836390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	38069389	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28440735, 28608901, 29679905, 30987086, 31366177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27170270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	25857617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22077634, 27091842, 27322610, 27345270, 28277986, 30057686, 34214916, 35944738, 36108803, 39370298, 40185339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29339024, 31078780	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	29743487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38063237	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	29928650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30386243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	16909019, 22353756, 28334913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	25505069	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	26393425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25669983, 26220195, 26483548, 27626179, 31423010, 39273003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29031566, 30405034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19187944, 20673799, 25280871, 27277809, 28156185, 28246026, 28515158, 28623000, 28899203, 29210072, 29494741, 29928650, 30038053, 30256716, 31529356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26087903, 30063300, 37919861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	29928650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	29018201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28472288, 29458173		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30262569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	25397683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28150717, 28267438, 31828114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	28373008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28373008, 28438659, 28964663, 29110132, 29917052, 29975120, 31052164, 31201843, 31351363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29104636, 29849452, 30468811, 31082959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29428410, 31601682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	36128875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28453992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36947579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25226504	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	26087903, 32102665, 35741045	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	26426434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17020408, 17234762, 17562481, 18829555, 19751820, 20122947, 20421815, 20440267, 20530669, 20534738, 20707922, 21248763, 21278237, 21482715, 21489257 View all (148 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	20507872, 23305850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	22215675, 29913224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	28233855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30599261		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	22855800, 26164630, 26551702, 29210072, 29969760, 30778297, 30790585, 31336872, 31784171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	30267739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11162512, 14985350, 18273910, 19573594, 20028456, 22020111, 22142473, 24005795, 25661352, 27023064, 27389776, 27686076, 27696114, 28000163, 28073699 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14985350, 22342995, 27023064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	26895301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17204939, 20196834, 23710289, 27554286, 29927029, 30273379, 31010806, 32672401, 36131631, 37919861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19359988, 19573594, 20202476, 20338236, 20446769, 21499987, 22227268, 22693571, 23000247, 23574943, 24382478, 24556215, 25280871, 26617217, 27554286 View all (40 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29143802, 30592963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	29143802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	29740449, 30529165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	20103708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21504366, 26120584, 28189916, 28209760, 28796629, 28932253, 29172017, 29261513, 29693586, 29860219, 30867696, 31076985, 31775341, 31838177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	25294219		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17020408, 17606720, 18829555, 19345732, 19638449, 19940992, 20446773, 20534738, 20682644, 21610322, 21964605, 22089114, 22249257, 22614957, 22684019 View all (38 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	22684020, 26482881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	22364184, 23592516, 26679056, 26919834, 27404485, 27634173, 29276215, 30279623, 30684890, 31514051		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	25294219		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	20089859, 21161163, 23319124, 27274779, 27866025, 28209760, 28254022, 28277986, 28420087, 28440735, 29129772, 29486138, 29566366, 29898626, 29905772 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25670728, 27274779, 27866025, 28277986, 30273379, 31366177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33765617, 37858747	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25172557, 28416489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	29684505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30779914, 31676390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	29494741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	22841931, 23612225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27863411, 28237856, 29339024, 37269815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	BEFREE	30474788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30550742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33355373	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	35609324	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	40289338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28515152, 29710518, 30742845, 31038249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29545917, 30030965, 30905781, 31004750, 31194955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26283888, 29061583, 31941496, 34109575, 36965071, 37353812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28010924, 31409554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	CTD_human_DG	26247513		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	23404377, 25270772, 28112439, 29212168, 29410730, 30166520, 30311581, 31472965, 31616183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24817946, 25114896, 25717032, 25841766, 26770651, 27713148, 28112439, 29410730, 30319732, 30597961, 33294122, 36724221, 37834202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35059466	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pachyonychia Congenita	Pachyonychia Congenita	BEFREE	27183391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21489257, 21734707, 24366069, 26117456, 26682003, 26980696, 27167341, 29240881, 29701272, 29765509, 29849873, 30355620, 30355942, 30735911, 30972876 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26915435, 27750041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21489257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20118824, 21489257, 25879528, 26497117, 27167341, 27756327, 28052097, 29701272, 29765509, 30972876, 31609478, 31785531, 33101586, 33446568, 35915609, 36497150, 37852325 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	26915435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30248482, 30798137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	26226105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31688588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	23365135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma type 2	Papillary Renal Carcinoma	BEFREE	23365135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23766517, 24138990, 26721202, 29469959, 29901070, 30697724, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	35300626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	16092930, 17204939, 20196834, 21747966, 26010367, 28349780, 29630901, 32784741, 33539026, 37371062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17015834, 19236154, 20196834, 21747966, 22513881, 23054368, 23106139, 23176750, 23223297, 25280871, 25496089, 26010367, 26116522, 26282218, 26526034 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29338172	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	26887053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	29205354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	31307745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	30565690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	29128794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28513573, 28617616, 30622677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37215133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	29540636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29540636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29530794, 30592963, 30593978, 30881589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	30593978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29530794, 30592963, 30593978, 30881589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	24204994	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	26471626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	35300626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Piebaldism	Piebaldism	BEFREE	27187376, 30942197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	30118661, 31552548		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	28932556, 28962820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31592832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36322230	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	20064547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29515258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	31443469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Ovarian Failure 1	Premature Ovarian Failure	CTD_human_DG	26247513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	20055754, 28333129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	25439478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	BEFREE	28805788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	25397683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30825315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	28229933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	29860433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20729872, 21837756, 24121106, 25266896, 25728635, 26227317, 27788496, 28978049, 29228771, 29247555, 29368435, 29383876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	33416009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	20124447, 23441843		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20682644, 24466341, 27788496, 30106110, 31389609, 33356808, 34163028, 34987184, 35438056, 36035281, 36295574, 36376959, 36517760, 39837010	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	28844677		★★★★★ ★☆☆☆☆ Found in Text Mining only
PSEUDOHYPOALDOSTERONISM, TYPE IID	Pseudohypoaldosteronism	BEFREE	31313673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24852654, 28576737, 30301214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	28918452, 30301214, 31710683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	30563490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31238128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	28062182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20534903, 24790085, 27555763, 27832175, 31238128, 31429757, 34934311, 35441963, 36724365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26861788, 32000766, 33967623	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	15520857, 19671143, 21318260, 22686525, 24783956, 27555763, 28006950, 28347799, 28886998, 29659176, 31297601, 31795292, 31814716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	23570914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27436123, 29108993, 29362432, 29864937, 30105924, 30219680, 30370641, 30474696, 31301076, 31611754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	28061437, 31372933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28061437, 29983865, 30896860, 31186733, 31483924, 31752777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23056222, 27840317, 28286065, 29126308, 29248720, 29621130, 29973206, 30431100, 30716432, 30925687, 31059771, 31632538, 31768838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	21376112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	29211853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28286065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	24783956, 30728889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	26077880, 28905450, 29512754, 29684352, 29805514, 30024305, 30728889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	20534903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	24783956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21087962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	28461502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	37079050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23717650, 30701326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	40226625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27744121, 28898138, 29656207, 29852739, 30355941, 30538709, 31475364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	23590302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	33992811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	23686862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23052169, 29515034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	25340789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	39519004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31278495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	24503019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26077880, 36913799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	17822364, 18981090, 21454555, 24474616, 25105464, 26253656, 27718499, 27899278, 29887956, 30034396, 30250973, 30465941, 30660872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	18629308, 25340789, 28061443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	24107458, 27183391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	18572023		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	BEFREE	25804610		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30159112	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29042934, 30159112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23667609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	23667609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	26935388		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	24413982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenic Diseases	Splenic Diseases	BEFREE	28246026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	28962820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	18572023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19967722, 20534738, 22614957, 22767273, 24386210, 25739673, 29306329, 30231242, 30411339, 31628914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24028437, 24307696, 24670651, 24724606, 26900290, 28365443, 28760781, 29675925, 29752726, 30409900, 31287493, 31755241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	25151357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23451093, 24386210, 25234657, 27736845, 27840932, 29053175, 29306329, 30046007, 32801084, 32814771, 33051434, 33859744, 34189138, 34212035, 34479919 View all (5 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	20421815, 22614957, 23545629, 25739673, 29191607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28887499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23451093, 24596130, 30376862, 31575007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	23686862, 28386312, 30592708, 30714645, 30983975, 31378559, 31574956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20677908, 21504366, 24170703, 24718268, 26120584, 26305715, 27837167, 28298541, 28386616, 28419832, 28555106, 28796629, 29309075, 30057681, 30807179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	28555106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28344324, 29091877, 29110625, 30504425, 30811526, 31629709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24175806, 25588809, 26410168, 30811526, 33079995, 33407483, 34098867, 34570396, 35237380, 35242279, 35417854, 37024798, 37488673, 37768308, 37958895, 38070189 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28928429, 29563984, 29966698, 30210141, 30779914, 30890112, 31191800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	35976433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28027929, 30177933		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31452195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	24277722, 28148553, 28704727, 29121589, 29860433, 30029164, 30769286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	29054545		★★★★★ ★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	24474616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	31705858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24138990, 29901070, 31591432, 32824922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36951264	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23766517, 24138990, 27856756, 29901070, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	31267862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23766517, 24138990, 29901070, 31428048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22691366, 24138990, 26700459, 27856756, 32824922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	35806120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29628876, 29685007, 29688134, 29750875, 30334406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29628876, 29685007, 29688134, 29750875, 30334406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26536456, 31313842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31379986, 33892113, 36432484, 37822991, 38600165, 39819723, 40613296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31506280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosinemias	Tyrosinemia	BEFREE	26551707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18613373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28050757, 28922365, 29518435, 29661352, 29710547, 29887940, 29941222, 30061089, 30149369, 30530041, 30594690, 31326516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29119264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	28785379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24919441, 25002527, 29248722, 31329868, 32273683, 34443505, 35031788, 36495164, 37108769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	29716554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28767070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26226105, 26915435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26247201	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24390348, 26247201, 28261610, 30058679, 35944738, 36424462, 38047020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21228930	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	33678318, 37773689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	28684304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29138814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	17255530, 20524845, 22575091, 25009787, 28429615, 28465407, 28542559, 31655958, 31769924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	18633117, 22685617, 25807533, 27374075, 37154169, 38069389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	39302489	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	BEFREE	18537816, 27222475, 28174051, 28186139, 28370349, 28836394, 29199612, 30338917, 31115551		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	24662764, 25029322, 27222475, 28186139, 30338917	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	CTD_human_DG	28836394		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	40723924	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18537816, 27222475, 28174051, 28186139, 28370349, 28836394, 29199612, 30338917, 31115551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	24284401		★★★★★ ★☆☆☆☆ Found in Text Mining only

NFE2L2 (NFE2 like bZIP transcription factor 2)