Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4776
Gene name	Nuclear factor of activated T cells 4
Gene symbol	NFATC4
Synonyms (NCBI Gene)	NF-AT3NF-ATC4NFAT3
Chromosome	14
Chromosome location	14q12
Summary	This gene encodes a member of the nuclear factor of activated T cells (NFAT) protein family. The encoded protein is part of a DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that trans

177

Show/Hide all (177)

miRTarBase ID	miRNA	Experiments	Reference
MIRT716663	hsa-miR-3667-5p	HITS-CLIP	19536157
MIRT716662	hsa-miR-1180-5p	HITS-CLIP	19536157
MIRT716661	hsa-miR-7114-3p	HITS-CLIP	19536157
MIRT716660	hsa-miR-4750-3p	HITS-CLIP	19536157
MIRT716663	hsa-miR-3667-5p	HITS-CLIP	19536157
MIRT716662	hsa-miR-1180-5p	HITS-CLIP	19536157
MIRT716661	hsa-miR-7114-3p	HITS-CLIP	19536157
MIRT716660	hsa-miR-4750-3p	HITS-CLIP	19536157
MIRT1182387	hsa-miR-1827	CLIP-seq
MIRT1182388	hsa-miR-31	CLIP-seq
MIRT1182389	hsa-miR-3153	CLIP-seq
MIRT1182390	hsa-miR-3173-3p	CLIP-seq
MIRT1182391	hsa-miR-3184	CLIP-seq
MIRT1182392	hsa-miR-320a	CLIP-seq
MIRT1182393	hsa-miR-320b	CLIP-seq
MIRT1182394	hsa-miR-320c	CLIP-seq
MIRT1182395	hsa-miR-320d	CLIP-seq
MIRT1182396	hsa-miR-3607-3p	CLIP-seq
MIRT1182397	hsa-miR-423-5p	CLIP-seq
MIRT1182398	hsa-miR-4429	CLIP-seq
MIRT1182399	hsa-miR-4649-3p	CLIP-seq
MIRT1182400	hsa-miR-4688	CLIP-seq
MIRT1182401	hsa-miR-4779	CLIP-seq
MIRT1182402	hsa-miR-486-3p	CLIP-seq
MIRT1182403	hsa-miR-1182	CLIP-seq
MIRT1182404	hsa-miR-1197	CLIP-seq
MIRT1182405	hsa-miR-185	CLIP-seq
MIRT1182406	hsa-miR-2054	CLIP-seq
MIRT1182407	hsa-miR-219-2-3p	CLIP-seq
MIRT1182408	hsa-miR-2964a-3p	CLIP-seq
MIRT1182409	hsa-miR-3150b-3p	CLIP-seq
MIRT1182410	hsa-miR-3157-3p	CLIP-seq
MIRT1182390	hsa-miR-3173-3p	CLIP-seq
MIRT1182411	hsa-miR-320e	CLIP-seq
MIRT1182412	hsa-miR-365	CLIP-seq
MIRT1182413	hsa-miR-378	CLIP-seq
MIRT1182414	hsa-miR-378b	CLIP-seq
MIRT1182415	hsa-miR-378c	CLIP-seq
MIRT1182416	hsa-miR-378d	CLIP-seq
MIRT1182417	hsa-miR-378e	CLIP-seq
MIRT1182418	hsa-miR-378f	CLIP-seq
MIRT1182419	hsa-miR-378h	CLIP-seq
MIRT1182420	hsa-miR-378i	CLIP-seq
MIRT1182421	hsa-miR-422a	CLIP-seq
MIRT1182422	hsa-miR-4306	CLIP-seq
MIRT1182423	hsa-miR-4452	CLIP-seq
MIRT1182424	hsa-miR-4638-3p	CLIP-seq
MIRT1182425	hsa-miR-4644	CLIP-seq
MIRT1182426	hsa-miR-4693-3p	CLIP-seq
MIRT1182427	hsa-miR-4784	CLIP-seq
MIRT1182428	hsa-miR-653	CLIP-seq
MIRT1182429	hsa-miR-711	CLIP-seq
MIRT1182430	hsa-miR-765	CLIP-seq
MIRT1182431	hsa-miR-1267	CLIP-seq
MIRT1182432	hsa-miR-361-3p	CLIP-seq
MIRT1182433	hsa-miR-4646-3p	CLIP-seq
MIRT1182434	hsa-miR-520a-5p	CLIP-seq
MIRT1182435	hsa-miR-525-5p	CLIP-seq
MIRT2052940	hsa-miR-603	CLIP-seq
MIRT2282133	hsa-miR-1228	CLIP-seq
MIRT2282134	hsa-miR-1254	CLIP-seq
MIRT2282135	hsa-miR-1470	CLIP-seq
MIRT2282136	hsa-miR-151-3p	CLIP-seq
MIRT2282137	hsa-miR-2467-3p	CLIP-seq
MIRT2282138	hsa-miR-3116	CLIP-seq
MIRT2282139	hsa-miR-3132	CLIP-seq
MIRT1182390	hsa-miR-3173-3p	CLIP-seq
MIRT2282140	hsa-miR-3183	CLIP-seq
MIRT1182391	hsa-miR-3184	CLIP-seq
MIRT2282141	hsa-miR-3529	CLIP-seq
MIRT1182396	hsa-miR-3607-3p	CLIP-seq
MIRT2282142	hsa-miR-3620	CLIP-seq
MIRT2282143	hsa-miR-3690	CLIP-seq
MIRT2282144	hsa-miR-378g	CLIP-seq
MIRT2282145	hsa-miR-379	CLIP-seq
MIRT2282146	hsa-miR-3919	CLIP-seq
MIRT2282147	hsa-miR-3944-5p	CLIP-seq
MIRT2282148	hsa-miR-412	CLIP-seq
MIRT1182397	hsa-miR-423-5p	CLIP-seq
MIRT2282149	hsa-miR-4330	CLIP-seq
MIRT2282150	hsa-miR-4433	CLIP-seq
MIRT2282151	hsa-miR-4463	CLIP-seq
MIRT2282152	hsa-miR-4469	CLIP-seq
MIRT2282153	hsa-miR-4499	CLIP-seq
MIRT2282154	hsa-miR-452	CLIP-seq
MIRT2282155	hsa-miR-4535	CLIP-seq
MIRT2282156	hsa-miR-4667-3p	CLIP-seq
MIRT2282157	hsa-miR-4676-3p	CLIP-seq
MIRT1182400	hsa-miR-4688	CLIP-seq
MIRT2282158	hsa-miR-4691-5p	CLIP-seq
MIRT2282159	hsa-miR-4723-3p	CLIP-seq
MIRT2282160	hsa-miR-4731-5p	CLIP-seq
MIRT2282161	hsa-miR-4756-3p	CLIP-seq
MIRT1182401	hsa-miR-4779	CLIP-seq
MIRT2282162	hsa-miR-485-5p	CLIP-seq
MIRT1182402	hsa-miR-486-3p	CLIP-seq
MIRT2282163	hsa-miR-492	CLIP-seq
MIRT2282164	hsa-miR-558	CLIP-seq
MIRT2282165	hsa-miR-665	CLIP-seq
MIRT2282166	hsa-miR-877	CLIP-seq
MIRT2465707	hsa-miR-125a-3p	CLIP-seq
MIRT2465708	hsa-miR-3155	CLIP-seq
MIRT2465709	hsa-miR-3155b	CLIP-seq
MIRT2465710	hsa-miR-3650	CLIP-seq
MIRT2465711	hsa-miR-484	CLIP-seq
MIRT2465712	hsa-miR-592	CLIP-seq
MIRT2465713	hsa-miR-597	CLIP-seq
MIRT2580257	hsa-miR-1207-3p	CLIP-seq
MIRT2282133	hsa-miR-1228	CLIP-seq
MIRT2580258	hsa-miR-1275	CLIP-seq
MIRT2282135	hsa-miR-1470	CLIP-seq
MIRT2580259	hsa-miR-29a	CLIP-seq
MIRT2580260	hsa-miR-29b	CLIP-seq
MIRT2580261	hsa-miR-29c	CLIP-seq
MIRT2580262	hsa-miR-3065-3p	CLIP-seq
MIRT1182432	hsa-miR-361-3p	CLIP-seq
MIRT2580263	hsa-miR-3616-3p	CLIP-seq
MIRT2282142	hsa-miR-3620	CLIP-seq
MIRT2580264	hsa-miR-3667-3p	CLIP-seq
MIRT2580265	hsa-miR-3679-3p	CLIP-seq
MIRT2580266	hsa-miR-3714	CLIP-seq
MIRT2282148	hsa-miR-412	CLIP-seq
MIRT2580267	hsa-miR-4264	CLIP-seq
MIRT2580268	hsa-miR-4290	CLIP-seq
MIRT2282152	hsa-miR-4469	CLIP-seq
MIRT2580269	hsa-miR-4525	CLIP-seq
MIRT2580270	hsa-miR-4650-5p	CLIP-seq
MIRT2580271	hsa-miR-4665-5p	CLIP-seq
MIRT2282156	hsa-miR-4667-3p	CLIP-seq
MIRT2580272	hsa-miR-4687-5p	CLIP-seq
MIRT2282158	hsa-miR-4691-5p	CLIP-seq
MIRT2580273	hsa-miR-4721	CLIP-seq
MIRT2580274	hsa-miR-4723-5p	CLIP-seq
MIRT2580275	hsa-miR-4728-5p	CLIP-seq
MIRT2282160	hsa-miR-4731-5p	CLIP-seq
MIRT2580276	hsa-miR-4733-3p	CLIP-seq
MIRT2580277	hsa-miR-483-3p	CLIP-seq
MIRT2580278	hsa-miR-544b	CLIP-seq
MIRT2052940	hsa-miR-603	CLIP-seq
MIRT2580279	hsa-miR-622	CLIP-seq
MIRT2580280	hsa-miR-625	CLIP-seq
MIRT2580281	hsa-miR-637	CLIP-seq
MIRT2580257	hsa-miR-1207-3p	CLIP-seq
MIRT2282133	hsa-miR-1228	CLIP-seq
MIRT2580258	hsa-miR-1275	CLIP-seq
MIRT2282135	hsa-miR-1470	CLIP-seq
MIRT2580259	hsa-miR-29a	CLIP-seq
MIRT2580260	hsa-miR-29b	CLIP-seq
MIRT2580261	hsa-miR-29c	CLIP-seq
MIRT2580262	hsa-miR-3065-3p	CLIP-seq
MIRT1182432	hsa-miR-361-3p	CLIP-seq
MIRT2580263	hsa-miR-3616-3p	CLIP-seq
MIRT2282142	hsa-miR-3620	CLIP-seq
MIRT2580264	hsa-miR-3667-3p	CLIP-seq
MIRT2580265	hsa-miR-3679-3p	CLIP-seq
MIRT2580266	hsa-miR-3714	CLIP-seq
MIRT2282148	hsa-miR-412	CLIP-seq
MIRT2580267	hsa-miR-4264	CLIP-seq
MIRT2580268	hsa-miR-4290	CLIP-seq
MIRT2282152	hsa-miR-4469	CLIP-seq
MIRT2580269	hsa-miR-4525	CLIP-seq
MIRT2580270	hsa-miR-4650-5p	CLIP-seq
MIRT2580271	hsa-miR-4665-5p	CLIP-seq
MIRT2282156	hsa-miR-4667-3p	CLIP-seq
MIRT2580272	hsa-miR-4687-5p	CLIP-seq
MIRT2282158	hsa-miR-4691-5p	CLIP-seq
MIRT2580273	hsa-miR-4721	CLIP-seq
MIRT2580274	hsa-miR-4723-5p	CLIP-seq
MIRT2580275	hsa-miR-4728-5p	CLIP-seq
MIRT2282160	hsa-miR-4731-5p	CLIP-seq
MIRT2580276	hsa-miR-4733-3p	CLIP-seq
MIRT2580277	hsa-miR-483-3p	CLIP-seq
MIRT2580278	hsa-miR-544b	CLIP-seq
MIRT2052940	hsa-miR-603	CLIP-seq
MIRT2580279	hsa-miR-622	CLIP-seq
MIRT2580280	hsa-miR-625	CLIP-seq
MIRT2580281	hsa-miR-637	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IGI	23543060
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	18218901, 19026640
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12370307
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	TAS	7749981
GO:0007507	Process	Heart development	IEA
GO:0007616	Process	Long-term memory	IEA
GO:0007616	Process	Long-term memory	ISS
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0031547	Process	Brain-derived neurotrophic factor receptor signaling pathway	IEA
GO:0031547	Process	Brain-derived neurotrophic factor receptor signaling pathway	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IBA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IEA
GO:0034644	Process	Cellular response to UV	IEA
GO:0035886	Process	Vascular associated smooth muscle cell differentiation	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045333	Process	Cellular respiration	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0050774	Process	Negative regulation of dendrite morphogenesis	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0060074	Process	Synapse maturation	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0097084	Process	Vascular associated smooth muscle cell development	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	IGI	23543060
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000297	Process	Negative regulation of synapse maturation	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
602699	7778	ENSG00000100968

Q14934

Protein name

Nuclear factor of activated T-cells, cytoplasmic 4 (NF-ATc4) (NFATc4) (T-cell transcription factor NFAT3) (NF-AT3)

Protein function

Ca(2+)-regulated transcription factor that is involved in several processes, including the development and function of the immune, cardiovascular, musculoskeletal, and nervous systems (PubMed:11514544, PubMed:11997522, PubMed:17213202, PubMed:17

PDB

2YRP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00554	RHD_DNA_bind	419 → 578	Rel homology DNA-binding domain	Domain
PF16179	RHD_dimer	587 → 687	Rel homology dimerisation domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with high levels in placenta, lung, kidney, testis and ovary (PubMed:18675896). Weakly expressed in spleen and thymus (PubMed:18675896). In the hippocampus, expressed in the granular layer of the dentate gyrus, in the

Sequence

MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITS
ISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEE
SVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRP
PYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQPPAV
SFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGY
NKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEP
PA

Sequence length

902

Interactions

View interactions

	KEGG
	Calcium signaling pathway cGMP-PKG signaling pathway Efferocytosis Cellular senescence Wnt signaling pathway Axon guidance C-type lectin receptor signaling pathway Oxytocin signaling pathway Hepatitis B Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	24583134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25422138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25422138	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20101218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16219765, 18668201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	37185612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34445576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33671013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34257525	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	18668201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	15012912	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15012912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24257415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22234350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22234350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19784808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19784808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	15012912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	25422138	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	31539560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	35812382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Bundle-Branch Block	Left Bundle-Branch Block	BEFREE	28772031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29670896		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	20535210		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	20535210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20101218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27893713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16219765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	19828810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27893713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24257415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34142171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31486013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37924098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20653821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	26527057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	31379853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Singleton Merten syndrome	Singleton Merten Syndrome	BEFREE	29626090		★★★★★ ★☆☆☆☆ Found in Text Mining only
SINGLETON-MERTEN SYNDROME 2	Singleton Merten Syndrome	BEFREE	29626090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33671013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NFATC4 (nuclear factor of activated T cells 4)