NF2 (NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor)

Gene

• Entrez ID: 4771
• Gene name: NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor
• Gene symbol: NF2
• Synonyms (NCBI Gene): ACN, BANF, SCH, SWNV, merlin-1
• Chromosome: 22
• Chromosome location: 22q12.2
• Summary: This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs74315492	T>C	Pathogenic	Coding sequence variant, intron variant, non coding transcript variant, missense variant
rs74315493	T>C	Pathogenic	Coding sequence variant, intron variant, non coding transcript variant, missense variant
rs74315494	A>C	Pathogenic	Coding sequence variant, intron variant, non coding transcript variant, missense variant
rs74315495	G>T	Pathogenic	Stop gained, coding sequence variant, intron variant, non coding transcript variant
rs74315496	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant, non coding transcript variant
rs74315497	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant, non coding transcript variant
rs74315499	C>G,T	Pathogenic	Coding sequence variant, intron variant, non coding transcript variant, stop gained, missense variant
rs74315501	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant, non coding transcript variant
rs74315503	G>A,T	Uncertain-significance, likely-benign, pathogenic	Coding sequence variant, intron variant, non coding transcript variant, stop gained, missense variant
rs74315504	C>G,T	Uncertain-significance, pathogenic	Coding sequence variant, intron variant, non coding transcript variant, stop gained, missense variant
rs74315505	G>T	Pathogenic	Stop gained, coding sequence variant, intron variant, non coding transcript variant
rs121434259	C>T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant, intron variant
rs121434260	CTT>-	Likely-pathogenic	Inframe deletion, coding sequence variant, non coding transcript variant, intron variant
rs121434261	T>C	Pathogenic	Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs147898623	C>T	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs372279458	A>G,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign, not-provided	Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs375819833	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Non coding transcript variant, intron variant, synonymous variant, coding sequence variant
rs587776562	G>T	Pathogenic	Intron variant, splice donor variant
rs587776563	A>-	Pathogenic	Intron variant, frameshift variant, coding sequence variant, non coding transcript variant
rs587776564	->G	Pathogenic	Intron variant, frameshift variant, coding sequence variant, non coding transcript variant
rs587776565	AAGGACA>-	Pathogenic	Intron variant, frameshift variant, coding sequence variant, non coding transcript variant
rs780872661	G>A,C,T	Pathogenic	Non coding transcript variant, intron variant, stop gained, missense variant, coding sequence variant
rs794728682	G>A	Pathogenic	Splice donor variant, intron variant
rs878853925	A>T	Pathogenic	Non coding transcript variant, coding sequence variant, intron variant, stop gained
rs917257652	C>G,T	Likely-benign, pathogenic	Coding sequence variant, intron variant, synonymous variant, stop gained, non coding transcript variant
rs1060503666	A>G	Pathogenic	Splice acceptor variant, intron variant
rs1060503667	C>G,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained, non coding transcript variant
rs1060503670	A>G	Pathogenic	Splice acceptor variant, intron variant
rs1064796632	G>A	Pathogenic	Splice acceptor variant, intron variant
rs1555978325	T>C	Likely-pathogenic	Non coding transcript variant, genic upstream transcript variant, missense variant, initiator codon variant
rs1555978356	A>T	Pathogenic	Non coding transcript variant, genic upstream transcript variant, coding sequence variant, stop gained
rs1555978369	AAGA>GT	Likely-pathogenic	Non coding transcript variant, genic upstream transcript variant, coding sequence variant, frameshift variant
rs1555986860	G>A	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained
rs1555987647	A>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1555987732	CTT>-	Likely-pathogenic	Non coding transcript variant, inframe deletion, intron variant, coding sequence variant
rs1555992948	C>-	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1555993293	G>A	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained
rs1555993301	GA>-	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1555993313	TT>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1555993336	C>T	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained
rs1555993345	C>T	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained
rs1555993352	G>T	Likely-pathogenic	Intron variant, splice donor variant
rs1555994816	G>A	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs1555994819	->A	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1555994854	G>A,C	Pathogenic, likely-pathogenic	Intron variant, splice donor variant
rs1555996156	TGAGAACAGACTGACCCCC>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1555998851	C>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1556000842	C>T	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained
rs1556001351	AA>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1556002457	A>-	Pathogenic	Intron variant, splice acceptor variant
rs1556002536	->G	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1556002568	T>C	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs1556003799	G>T	Pathogenic	Intron variant, splice donor variant
rs1556003801	T>A	Likely-pathogenic	Intron variant, splice donor variant
rs1569293373	->ACCCCAGTGTTCACAAGCG	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1569293488	T>G	Likely-pathogenic	Intron variant, splice donor variant
rs1569294187	CACCGAG>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1569302393	G>A	Pathogenic	Intron variant, splice donor variant
rs1569304774	G>A	Likely-pathogenic	Intron variant, splice donor variant
rs1601515836	C>-	Pathogenic	Non coding transcript variant, genic upstream transcript variant, coding sequence variant, frameshift variant
rs1601515970	->C	Pathogenic	Non coding transcript variant, genic upstream transcript variant, coding sequence variant, frameshift variant
rs1601579095	GGTTCTT>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601579295	CTCAAAATGGACAAGAAGGTTGGGCT>-	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, splice donor variant
rs1601611973	C>T	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained
rs1601612044	G>A	Pathogenic	Intron variant, splice donor variant
rs1601613230	TTTTGTAAAAATGATGCATAATTATAAAAGTGGCAAACAATACCAAATTTACTTCATGTGTAGGTTTTTTATTTTGCTCTATTTTTTGGTAGGTAATAAATCTGTATCAGATGACTCCGGAAATGTGGGAGGAGAGAATTACTG>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, splice acceptor variant
rs1601618501	A>G	Pathogenic	Intron variant, splice acceptor variant
rs1601618585	T>C	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs1601618646	A>T	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs1601624078	AGACTGAC>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601624296	T>C	Pathogenic	Intron variant, splice donor variant
rs1601636894	G>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601643866	G>T	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained
rs1601643896	->C	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601644130	G>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601644146	G>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601648452	A>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601649018	AGAG>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1601649049	T>G	Pathogenic	Intron variant, splice donor variant
rs1601652425	G>A	Likely-pathogenic	Intron variant, splice donor variant
rs1601666156	T>A	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003573	hsa-miR-98-5p	Review	19815577
MIRT001853	hsa-let-7a-5p	Review	19815577
MIRT001853	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	17220301
MIRT001853	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	17220301
MIRT016579	hsa-miR-193b-3p	Microarray	20304954
MIRT001853	hsa-let-7a-5p	Reporter assay;Other	17220301
MIRT047749	hsa-miR-10a-5p	CLASH	23622248
MIRT036332	hsa-miR-1229-3p	CLASH	23622248
MIRT610917	hsa-miR-8485	HITS-CLIP	19536157
MIRT610916	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT610915	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT610907	hsa-miR-4696	HITS-CLIP	19536157
MIRT610906	hsa-miR-4312	HITS-CLIP	19536157
MIRT682976	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682975	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682974	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT682973	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682972	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT254654	hsa-miR-4486	HITS-CLIP	23706177
MIRT682971	hsa-miR-3117-5p	HITS-CLIP	23706177
MIRT682970	hsa-miR-661	HITS-CLIP	23706177
MIRT682969	hsa-miR-1273a	HITS-CLIP	23706177
MIRT682968	hsa-miR-4649-5p	HITS-CLIP	23706177
MIRT682967	hsa-miR-6729-5p	HITS-CLIP	23706177
MIRT682966	hsa-miR-7703	HITS-CLIP	23706177
MIRT682965	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT087451	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT087454	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT087452	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT087456	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT087453	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT087455	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT254663	hsa-miR-6085	PAR-CLIP	20371350
MIRT254665	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT561860	hsa-miR-3922-5p	PAR-CLIP	20371350
MIRT254650	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT254645	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT561859	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT254657	hsa-miR-4505	PAR-CLIP	20371350
MIRT254662	hsa-miR-5787	PAR-CLIP	20371350
MIRT254655	hsa-miR-4492	PAR-CLIP	20371350
MIRT254656	hsa-miR-4498	PAR-CLIP	20371350
MIRT254660	hsa-miR-5001-5p	PAR-CLIP	20371350
MIRT254647	hsa-miR-762	PAR-CLIP	20371350
MIRT254644	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT561858	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT087451	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT087454	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT087452	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT087456	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT087453	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT087455	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT254663	hsa-miR-6085	PAR-CLIP	20371350
MIRT254665	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT561860	hsa-miR-3922-5p	PAR-CLIP	20371350
MIRT254650	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT254645	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT561859	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT254657	hsa-miR-4505	PAR-CLIP	20371350
MIRT254662	hsa-miR-5787	PAR-CLIP	20371350
MIRT254655	hsa-miR-4492	PAR-CLIP	20371350
MIRT254656	hsa-miR-4498	PAR-CLIP	20371350
MIRT254660	hsa-miR-5001-5p	PAR-CLIP	20371350
MIRT254647	hsa-miR-762	PAR-CLIP	20371350
MIRT254644	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT561858	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT498329	hsa-miR-5681a	PAR-CLIP	22291592
MIRT498328	hsa-miR-31-5p	PAR-CLIP	22291592
MIRT498327	hsa-miR-4668-5p	PAR-CLIP	22291592
MIRT472328	hsa-miR-302f	PAR-CLIP	23592263
MIRT472327	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT472326	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT472325	hsa-miR-940	PAR-CLIP	23592263
MIRT472324	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT472323	hsa-miR-4459	PAR-CLIP	23592263
MIRT472322	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT472320	hsa-miR-1827	PAR-CLIP	23592263
MIRT472321	hsa-miR-6087	PAR-CLIP	23592263
MIRT472319	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT472318	hsa-miR-658	PAR-CLIP	23592263
MIRT472317	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT472316	hsa-miR-4497	PAR-CLIP	23592263
MIRT472315	hsa-miR-1273e	PAR-CLIP	23592263
MIRT254654	hsa-miR-4486	PAR-CLIP	26701625
MIRT472319	hsa-miR-4722-5p	PAR-CLIP	27292025
MIRT472319	hsa-miR-4722-5p	PAR-CLIP	27292025
MIRT472319	hsa-miR-4722-5p	PAR-CLIP	27292025
MIRT472324	hsa-miR-4768-3p	PAR-CLIP	27292025
MIRT472324	hsa-miR-4768-3p	PAR-CLIP	27292025
MIRT472324	hsa-miR-4768-3p	PAR-CLIP	27292025
MIRT610917	hsa-miR-8485	HITS-CLIP	19536157
MIRT610916	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT610915	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT610907	hsa-miR-4696	HITS-CLIP	19536157
MIRT610906	hsa-miR-4312	HITS-CLIP	19536157
MIRT682976	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682975	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682974	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT682973	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682972	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT254654	hsa-miR-4486	HITS-CLIP	23706177
MIRT682971	hsa-miR-3117-5p	HITS-CLIP	23706177
MIRT682970	hsa-miR-661	HITS-CLIP	23706177
MIRT682969	hsa-miR-1273a	HITS-CLIP	23706177
MIRT682968	hsa-miR-4649-5p	HITS-CLIP	23706177
MIRT682967	hsa-miR-6729-5p	HITS-CLIP	23706177
MIRT682966	hsa-miR-7703	HITS-CLIP	23706177
MIRT682965	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT610917	hsa-miR-8485	HITS-CLIP	23824327
MIRT610916	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610915	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610914	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT610913	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT610912	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT610911	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT610910	hsa-miR-3666	HITS-CLIP	23824327
MIRT610909	hsa-miR-4295	HITS-CLIP	23824327
MIRT610908	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT610907	hsa-miR-4696	HITS-CLIP	23824327
MIRT610906	hsa-miR-4312	HITS-CLIP	23824327
MIRT087451	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT087454	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT087452	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT087456	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT087453	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT087455	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT254663	hsa-miR-6085	PAR-CLIP	20371350
MIRT254665	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT561860	hsa-miR-3922-5p	PAR-CLIP	20371350
MIRT254650	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT254645	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT561859	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT254657	hsa-miR-4505	PAR-CLIP	20371350
MIRT254662	hsa-miR-5787	PAR-CLIP	20371350
MIRT254655	hsa-miR-4492	PAR-CLIP	20371350
MIRT254656	hsa-miR-4498	PAR-CLIP	20371350
MIRT254660	hsa-miR-5001-5p	PAR-CLIP	20371350
MIRT254647	hsa-miR-762	PAR-CLIP	20371350
MIRT254644	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT561858	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT087451	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT087454	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT087452	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT087456	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT087453	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT087455	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT254663	hsa-miR-6085	PAR-CLIP	20371350
MIRT254665	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT561860	hsa-miR-3922-5p	PAR-CLIP	20371350
MIRT254650	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT254645	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT561859	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT254657	hsa-miR-4505	PAR-CLIP	20371350
MIRT254662	hsa-miR-5787	PAR-CLIP	20371350
MIRT254655	hsa-miR-4492	PAR-CLIP	20371350
MIRT254656	hsa-miR-4498	PAR-CLIP	20371350
MIRT254660	hsa-miR-5001-5p	PAR-CLIP	20371350
MIRT254647	hsa-miR-762	PAR-CLIP	20371350
MIRT254644	hsa-miR-185-3p	PAR-CLIP	20371350
MIRT561858	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT498329	hsa-miR-5681a	PAR-CLIP	22291592
MIRT498328	hsa-miR-31-5p	PAR-CLIP	22291592
MIRT498327	hsa-miR-4668-5p	PAR-CLIP	22291592
MIRT472328	hsa-miR-302f	PAR-CLIP	23592263
MIRT472327	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT472326	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT472325	hsa-miR-940	PAR-CLIP	23592263
MIRT472324	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT472323	hsa-miR-4459	PAR-CLIP	23592263
MIRT472322	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT472320	hsa-miR-1827	PAR-CLIP	23592263
MIRT472321	hsa-miR-6087	PAR-CLIP	23592263
MIRT472319	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT472318	hsa-miR-658	PAR-CLIP	23592263
MIRT472317	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT472316	hsa-miR-4497	PAR-CLIP	23592263
MIRT472315	hsa-miR-1273e	PAR-CLIP	23592263
MIRT1181539	hsa-miR-1273	CLIP-seq
MIRT1181540	hsa-miR-139-5p	CLIP-seq
MIRT1181541	hsa-miR-146a	CLIP-seq
MIRT1181542	hsa-miR-146b-5p	CLIP-seq
MIRT1181543	hsa-miR-149	CLIP-seq
MIRT1181544	hsa-miR-1908	CLIP-seq
MIRT1181545	hsa-miR-1915	CLIP-seq
MIRT1181546	hsa-miR-2114	CLIP-seq
MIRT1181547	hsa-miR-216b	CLIP-seq
MIRT1181548	hsa-miR-24	CLIP-seq
MIRT1181549	hsa-miR-25	CLIP-seq
MIRT1181550	hsa-miR-2861	CLIP-seq
MIRT1181551	hsa-miR-2964a-3p	CLIP-seq
MIRT1181552	hsa-miR-3064-5p	CLIP-seq
MIRT1181553	hsa-miR-3120-3p	CLIP-seq
MIRT1181554	hsa-miR-3122	CLIP-seq
MIRT1181555	hsa-miR-3126-5p	CLIP-seq
MIRT1181556	hsa-miR-3127-5p	CLIP-seq
MIRT1181557	hsa-miR-3144-5p	CLIP-seq
MIRT1181558	hsa-miR-3153	CLIP-seq
MIRT1181559	hsa-miR-3154	CLIP-seq
MIRT1181560	hsa-miR-3179	CLIP-seq
MIRT1181561	hsa-miR-3184	CLIP-seq
MIRT1181562	hsa-miR-32	CLIP-seq
MIRT1181563	hsa-miR-323-5p	CLIP-seq
MIRT1181564	hsa-miR-342-5p	CLIP-seq
MIRT1181565	hsa-miR-3545-3p	CLIP-seq
MIRT1181566	hsa-miR-3609	CLIP-seq
MIRT1181567	hsa-miR-361-3p	CLIP-seq
MIRT1181568	hsa-miR-3622a-3p	CLIP-seq
MIRT1181569	hsa-miR-3622b-3p	CLIP-seq
MIRT1181570	hsa-miR-3622b-5p	CLIP-seq
MIRT1181571	hsa-miR-363	CLIP-seq
MIRT1181572	hsa-miR-3647-3p	CLIP-seq
MIRT1181573	hsa-miR-365	CLIP-seq
MIRT1181574	hsa-miR-367	CLIP-seq
MIRT1181575	hsa-miR-3675-3p	CLIP-seq
MIRT1181576	hsa-miR-3682-5p	CLIP-seq
MIRT1181577	hsa-miR-3689a-3p	CLIP-seq
MIRT1181578	hsa-miR-3689c	CLIP-seq
MIRT1181579	hsa-miR-3689d	CLIP-seq
MIRT1181580	hsa-miR-380	CLIP-seq
MIRT1181581	hsa-miR-3913-5p	CLIP-seq
MIRT1181582	hsa-miR-3918	CLIP-seq
MIRT1181583	hsa-miR-3919	CLIP-seq
MIRT1181584	hsa-miR-3924	CLIP-seq
MIRT1181585	hsa-miR-3925-5p	CLIP-seq
MIRT1181586	hsa-miR-3929	CLIP-seq
MIRT1181587	hsa-miR-412	CLIP-seq
MIRT1181588	hsa-miR-4253	CLIP-seq
MIRT1181589	hsa-miR-4284	CLIP-seq
MIRT1181590	hsa-miR-4311	CLIP-seq
MIRT1181591	hsa-miR-4419b	CLIP-seq
MIRT1181592	hsa-miR-4432	CLIP-seq
MIRT1181593	hsa-miR-4433	CLIP-seq
MIRT1181594	hsa-miR-4437	CLIP-seq
MIRT1181595	hsa-miR-4476	CLIP-seq
MIRT1181596	hsa-miR-4478	CLIP-seq
MIRT1181597	hsa-miR-4495	CLIP-seq
MIRT1181598	hsa-miR-4512	CLIP-seq
MIRT1181599	hsa-miR-4649-3p	CLIP-seq
MIRT1181600	hsa-miR-4651	CLIP-seq
MIRT1181601	hsa-miR-4664-5p	CLIP-seq
MIRT1181602	hsa-miR-4671-5p	CLIP-seq
MIRT1181603	hsa-miR-4674	CLIP-seq
MIRT1181604	hsa-miR-4680-5p	CLIP-seq
MIRT1181605	hsa-miR-4684-5p	CLIP-seq
MIRT1181606	hsa-miR-4706	CLIP-seq
MIRT1181607	hsa-miR-4728-5p	CLIP-seq
MIRT1181608	hsa-miR-4747-5p	CLIP-seq
MIRT1181609	hsa-miR-4749-5p	CLIP-seq
MIRT1181610	hsa-miR-4756-3p	CLIP-seq
MIRT1181611	hsa-miR-4786-5p	CLIP-seq
MIRT1181612	hsa-miR-4794	CLIP-seq
MIRT1181613	hsa-miR-485-5p	CLIP-seq
MIRT1181614	hsa-miR-510	CLIP-seq
MIRT1181615	hsa-miR-516b	CLIP-seq
MIRT1181616	hsa-miR-520g	CLIP-seq
MIRT1181617	hsa-miR-520h	CLIP-seq
MIRT1181618	hsa-miR-541	CLIP-seq
MIRT1181619	hsa-miR-544b	CLIP-seq
MIRT1181620	hsa-miR-545	CLIP-seq
MIRT1181621	hsa-miR-548ah	CLIP-seq
MIRT1181622	hsa-miR-548c-3p	CLIP-seq
MIRT1181623	hsa-miR-548u	CLIP-seq
MIRT1181624	hsa-miR-608	CLIP-seq
MIRT1181625	hsa-miR-622	CLIP-seq
MIRT1181626	hsa-miR-649	CLIP-seq
MIRT1181627	hsa-miR-654-5p	CLIP-seq
MIRT1181628	hsa-miR-663	CLIP-seq
MIRT1181629	hsa-miR-671-5p	CLIP-seq
MIRT1181630	hsa-miR-7	CLIP-seq
MIRT1181631	hsa-miR-711	CLIP-seq
MIRT1181632	hsa-miR-766	CLIP-seq
MIRT1181633	hsa-miR-876-3p	CLIP-seq
MIRT1181634	hsa-miR-890	CLIP-seq
MIRT1181635	hsa-miR-92a	CLIP-seq
MIRT1181636	hsa-miR-92b	CLIP-seq
MIRT1181637	hsa-miR-185	CLIP-seq
MIRT1181638	hsa-miR-2467-3p	CLIP-seq
MIRT1181639	hsa-miR-298	CLIP-seq
MIRT1181640	hsa-miR-3125	CLIP-seq
MIRT1181558	hsa-miR-3153	CLIP-seq
MIRT1181641	hsa-miR-3916	CLIP-seq
MIRT1181642	hsa-miR-3944-5p	CLIP-seq
MIRT1181643	hsa-miR-4257	CLIP-seq
MIRT1181644	hsa-miR-4306	CLIP-seq
MIRT1181645	hsa-miR-4509	CLIP-seq
MIRT1181646	hsa-miR-4644	CLIP-seq
MIRT1181647	hsa-miR-4744	CLIP-seq
MIRT1181648	hsa-miR-4802-5p	CLIP-seq
MIRT1181649	hsa-miR-1207-3p	CLIP-seq
MIRT1181650	hsa-miR-1299	CLIP-seq
MIRT1181651	hsa-miR-1343	CLIP-seq
MIRT1181540	hsa-miR-139-5p	CLIP-seq
MIRT1181652	hsa-miR-15a	CLIP-seq
MIRT1181653	hsa-miR-15b	CLIP-seq
MIRT1181654	hsa-miR-16	CLIP-seq
MIRT1181655	hsa-miR-188-3p	CLIP-seq
MIRT1181656	hsa-miR-195	CLIP-seq
MIRT1181657	hsa-miR-1976	CLIP-seq
MIRT1181658	hsa-miR-2110	CLIP-seq
MIRT1181547	hsa-miR-216b	CLIP-seq
MIRT1181548	hsa-miR-24	CLIP-seq
MIRT1181549	hsa-miR-25	CLIP-seq
MIRT1181551	hsa-miR-2964a-3p	CLIP-seq
MIRT1181659	hsa-miR-3065-3p	CLIP-seq
MIRT1181554	hsa-miR-3122	CLIP-seq
MIRT1181558	hsa-miR-3153	CLIP-seq
MIRT1181561	hsa-miR-3184	CLIP-seq
MIRT1181660	hsa-miR-3192	CLIP-seq
MIRT1181562	hsa-miR-32	CLIP-seq
MIRT1181564	hsa-miR-342-5p	CLIP-seq
MIRT1181661	hsa-miR-3616-5p	CLIP-seq
MIRT1181568	hsa-miR-3622a-3p	CLIP-seq
MIRT1181569	hsa-miR-3622b-3p	CLIP-seq
MIRT1181570	hsa-miR-3622b-5p	CLIP-seq
MIRT1181571	hsa-miR-363	CLIP-seq
MIRT1181662	hsa-miR-3647-5p	CLIP-seq
MIRT1181573	hsa-miR-365	CLIP-seq
MIRT1181663	hsa-miR-3652	CLIP-seq
MIRT1181574	hsa-miR-367	CLIP-seq
MIRT1181575	hsa-miR-3675-3p	CLIP-seq
MIRT1181577	hsa-miR-3689a-3p	CLIP-seq
MIRT1181578	hsa-miR-3689c	CLIP-seq
MIRT1181579	hsa-miR-3689d	CLIP-seq
MIRT1181664	hsa-miR-370	CLIP-seq
MIRT1181580	hsa-miR-380	CLIP-seq
MIRT1181581	hsa-miR-3913-5p	CLIP-seq
MIRT1181665	hsa-miR-3914	CLIP-seq
MIRT1181584	hsa-miR-3924	CLIP-seq
MIRT1181586	hsa-miR-3929	CLIP-seq
MIRT1181587	hsa-miR-412	CLIP-seq
MIRT1181666	hsa-miR-424	CLIP-seq
MIRT1181588	hsa-miR-4253	CLIP-seq
MIRT1181667	hsa-miR-4271	CLIP-seq
MIRT1181668	hsa-miR-4279	CLIP-seq
MIRT1181669	hsa-miR-4283	CLIP-seq
MIRT1181589	hsa-miR-4284	CLIP-seq
MIRT1181670	hsa-miR-4293	CLIP-seq
MIRT1181591	hsa-miR-4419b	CLIP-seq
MIRT1181671	hsa-miR-4430	CLIP-seq
MIRT1181593	hsa-miR-4433	CLIP-seq
MIRT1181596	hsa-miR-4478	CLIP-seq
MIRT1181672	hsa-miR-4489	CLIP-seq
MIRT1181597	hsa-miR-4495	CLIP-seq
MIRT1181673	hsa-miR-4633-3p	CLIP-seq
MIRT1181674	hsa-miR-4645-5p	CLIP-seq
MIRT1181599	hsa-miR-4649-3p	CLIP-seq
MIRT1181600	hsa-miR-4651	CLIP-seq
MIRT1181675	hsa-miR-4662a-5p	CLIP-seq
MIRT1181601	hsa-miR-4664-5p	CLIP-seq
MIRT1181676	hsa-miR-4667-5p	CLIP-seq
MIRT1181677	hsa-miR-4673	CLIP-seq
MIRT1181678	hsa-miR-4676-5p	CLIP-seq
MIRT1181679	hsa-miR-4677-3p	CLIP-seq
MIRT1181680	hsa-miR-4679	CLIP-seq
MIRT1181605	hsa-miR-4684-5p	CLIP-seq
MIRT1181681	hsa-miR-4691-3p	CLIP-seq
MIRT1181682	hsa-miR-4700-5p	CLIP-seq
MIRT1181683	hsa-miR-4712-3p	CLIP-seq
MIRT1181684	hsa-miR-4725-3p	CLIP-seq
MIRT1181607	hsa-miR-4728-5p	CLIP-seq
MIRT1181685	hsa-miR-4731-5p	CLIP-seq
MIRT1181608	hsa-miR-4747-5p	CLIP-seq
MIRT1181686	hsa-miR-4753-3p	CLIP-seq
MIRT1181687	hsa-miR-4755-3p	CLIP-seq
MIRT1181688	hsa-miR-4782-5p	CLIP-seq
MIRT1181611	hsa-miR-4786-5p	CLIP-seq
MIRT1181689	hsa-miR-4802-3p	CLIP-seq
MIRT1181690	hsa-miR-4804-5p	CLIP-seq
MIRT1181613	hsa-miR-485-5p	CLIP-seq
MIRT1181691	hsa-miR-497	CLIP-seq
MIRT1181692	hsa-miR-5095	CLIP-seq
MIRT1181693	hsa-miR-512-5p	CLIP-seq
MIRT1181615	hsa-miR-516b	CLIP-seq
MIRT1181694	hsa-miR-539	CLIP-seq
MIRT1181618	hsa-miR-541	CLIP-seq
MIRT1181619	hsa-miR-544b	CLIP-seq
MIRT1181695	hsa-miR-548a-5p	CLIP-seq
MIRT1181696	hsa-miR-548aa	CLIP-seq
MIRT1181697	hsa-miR-548ab	CLIP-seq
MIRT1181698	hsa-miR-548ak	CLIP-seq
MIRT1181699	hsa-miR-548b-5p	CLIP-seq
MIRT1181622	hsa-miR-548c-3p	CLIP-seq
MIRT1181700	hsa-miR-548c-5p	CLIP-seq
MIRT1181701	hsa-miR-548d-5p	CLIP-seq
MIRT1181702	hsa-miR-548h	CLIP-seq
MIRT1181703	hsa-miR-548i	CLIP-seq
MIRT1181704	hsa-miR-548j	CLIP-seq
MIRT1181705	hsa-miR-548w	CLIP-seq
MIRT1181706	hsa-miR-548y	CLIP-seq
MIRT1181707	hsa-miR-550a	CLIP-seq
MIRT1181708	hsa-miR-552	CLIP-seq
MIRT1181709	hsa-miR-559	CLIP-seq
MIRT1181710	hsa-miR-570	CLIP-seq
MIRT1181711	hsa-miR-573	CLIP-seq
MIRT1181712	hsa-miR-575	CLIP-seq
MIRT1181624	hsa-miR-608	CLIP-seq
MIRT1181625	hsa-miR-622	CLIP-seq
MIRT1181627	hsa-miR-654-5p	CLIP-seq
MIRT1181629	hsa-miR-671-5p	CLIP-seq
MIRT1181713	hsa-miR-873	CLIP-seq
MIRT1181635	hsa-miR-92a	CLIP-seq
MIRT1181636	hsa-miR-92b	CLIP-seq
MIRT1551734	hsa-miR-1291	CLIP-seq
MIRT1181570	hsa-miR-3622b-5p	CLIP-seq
MIRT1181553	hsa-miR-3120-3p	CLIP-seq
MIRT1181555	hsa-miR-3126-5p	CLIP-seq
MIRT1181620	hsa-miR-545	CLIP-seq
MIRT1181540	hsa-miR-139-5p	CLIP-seq
MIRT1181575	hsa-miR-3675-3p	CLIP-seq
MIRT1181605	hsa-miR-4684-5p	CLIP-seq
MIRT2052548	hsa-miR-103b	CLIP-seq
MIRT2052549	hsa-miR-1184	CLIP-seq
MIRT1181649	hsa-miR-1207-3p	CLIP-seq
MIRT2052550	hsa-miR-1226	CLIP-seq
MIRT2052551	hsa-miR-1227	CLIP-seq
MIRT1551734	hsa-miR-1291	CLIP-seq
MIRT2052552	hsa-miR-1301	CLIP-seq
MIRT2052553	hsa-miR-1914	CLIP-seq
MIRT1181545	hsa-miR-1915	CLIP-seq
MIRT1181658	hsa-miR-2110	CLIP-seq
MIRT1181546	hsa-miR-2114	CLIP-seq
MIRT1181547	hsa-miR-216b	CLIP-seq
MIRT2052554	hsa-miR-223	CLIP-seq
MIRT2052555	hsa-miR-2277-3p	CLIP-seq
MIRT1181549	hsa-miR-25	CLIP-seq
MIRT1181550	hsa-miR-2861	CLIP-seq
MIRT1181551	hsa-miR-2964a-3p	CLIP-seq
MIRT2052556	hsa-miR-296-5p	CLIP-seq
MIRT2052557	hsa-miR-3064-3p	CLIP-seq
MIRT1181552	hsa-miR-3064-5p	CLIP-seq
MIRT1181558	hsa-miR-3153	CLIP-seq
MIRT1181559	hsa-miR-3154	CLIP-seq
MIRT1181560	hsa-miR-3179	CLIP-seq
MIRT1181561	hsa-miR-3184	CLIP-seq
MIRT1181660	hsa-miR-3192	CLIP-seq
MIRT1181562	hsa-miR-32	CLIP-seq
MIRT2052558	hsa-miR-323b-5p	CLIP-seq
MIRT1181564	hsa-miR-342-5p	CLIP-seq
MIRT1181565	hsa-miR-3545-3p	CLIP-seq
MIRT2052559	hsa-miR-3613-3p	CLIP-seq
MIRT1181567	hsa-miR-361-3p	CLIP-seq
MIRT1181571	hsa-miR-363	CLIP-seq
MIRT1181572	hsa-miR-3647-3p	CLIP-seq
MIRT1181573	hsa-miR-365	CLIP-seq
MIRT1181663	hsa-miR-3652	CLIP-seq
MIRT2052560	hsa-miR-3664-3p	CLIP-seq
MIRT1181574	hsa-miR-367	CLIP-seq
MIRT1181577	hsa-miR-3689a-3p	CLIP-seq
MIRT1181578	hsa-miR-3689c	CLIP-seq
MIRT1181579	hsa-miR-3689d	CLIP-seq
MIRT1181580	hsa-miR-380	CLIP-seq
MIRT2052561	hsa-miR-3915	CLIP-seq
MIRT1181582	hsa-miR-3918	CLIP-seq
MIRT1181584	hsa-miR-3924	CLIP-seq
MIRT2052562	hsa-miR-3928	CLIP-seq
MIRT1181586	hsa-miR-3929	CLIP-seq
MIRT1181587	hsa-miR-412	CLIP-seq
MIRT2052563	hsa-miR-4267	CLIP-seq
MIRT1181667	hsa-miR-4271	CLIP-seq
MIRT2052564	hsa-miR-4276	CLIP-seq
MIRT2052565	hsa-miR-4287	CLIP-seq
MIRT2052566	hsa-miR-4292	CLIP-seq
MIRT2052567	hsa-miR-4308	CLIP-seq
MIRT1181590	hsa-miR-4311	CLIP-seq
MIRT2052568	hsa-miR-4325	CLIP-seq
MIRT2052569	hsa-miR-4418	CLIP-seq
MIRT1181591	hsa-miR-4419b	CLIP-seq
MIRT1181671	hsa-miR-4430	CLIP-seq
MIRT1181593	hsa-miR-4433	CLIP-seq
MIRT2052570	hsa-miR-4462	CLIP-seq
MIRT2052571	hsa-miR-4469	CLIP-seq
MIRT1181596	hsa-miR-4478	CLIP-seq
MIRT1181597	hsa-miR-4495	CLIP-seq
MIRT1181598	hsa-miR-4512	CLIP-seq
MIRT2052572	hsa-miR-4537	CLIP-seq
MIRT1181673	hsa-miR-4633-3p	CLIP-seq
MIRT2052573	hsa-miR-4640-5p	CLIP-seq
MIRT1181599	hsa-miR-4649-3p	CLIP-seq
MIRT2052574	hsa-miR-4660	CLIP-seq
MIRT1181601	hsa-miR-4664-5p	CLIP-seq
MIRT1181676	hsa-miR-4667-5p	CLIP-seq
MIRT1181604	hsa-miR-4680-5p	CLIP-seq
MIRT2052575	hsa-miR-4685-3p	CLIP-seq
MIRT2052576	hsa-miR-4697-3p	CLIP-seq
MIRT1181682	hsa-miR-4700-5p	CLIP-seq
MIRT2052577	hsa-miR-4722-3p	CLIP-seq
MIRT1181684	hsa-miR-4725-3p	CLIP-seq
MIRT2052578	hsa-miR-4726-5p	CLIP-seq
MIRT1181607	hsa-miR-4728-5p	CLIP-seq
MIRT1181685	hsa-miR-4731-5p	CLIP-seq
MIRT2052579	hsa-miR-4746-3p	CLIP-seq
MIRT1181687	hsa-miR-4755-3p	CLIP-seq
MIRT2052580	hsa-miR-4792	CLIP-seq
MIRT1181689	hsa-miR-4802-3p	CLIP-seq
MIRT1181613	hsa-miR-485-5p	CLIP-seq
MIRT2052581	hsa-miR-499a-5p	CLIP-seq
MIRT2052582	hsa-miR-5047	CLIP-seq
MIRT2052583	hsa-miR-509-3-5p	CLIP-seq
MIRT2052584	hsa-miR-509-5p	CLIP-seq
MIRT1181614	hsa-miR-510	CLIP-seq
MIRT1181693	hsa-miR-512-5p	CLIP-seq
MIRT1181615	hsa-miR-516b	CLIP-seq
MIRT2052585	hsa-miR-619	CLIP-seq
MIRT1181625	hsa-miR-622	CLIP-seq
MIRT2052586	hsa-miR-626	CLIP-seq
MIRT2052587	hsa-miR-635	CLIP-seq
MIRT2052588	hsa-miR-643	CLIP-seq
MIRT1181626	hsa-miR-649	CLIP-seq
MIRT1181632	hsa-miR-766	CLIP-seq
MIRT1181634	hsa-miR-890	CLIP-seq
MIRT1181635	hsa-miR-92a	CLIP-seq
MIRT1181636	hsa-miR-92b	CLIP-seq
MIRT2281947	hsa-miR-3177-3p	CLIP-seq
MIRT1181545	hsa-miR-1915	CLIP-seq
MIRT1181549	hsa-miR-25	CLIP-seq
MIRT1181562	hsa-miR-32	CLIP-seq
MIRT1181571	hsa-miR-363	CLIP-seq
MIRT1181572	hsa-miR-3647-3p	CLIP-seq
MIRT1181574	hsa-miR-367	CLIP-seq
MIRT2052569	hsa-miR-4418	CLIP-seq
MIRT1181600	hsa-miR-4651	CLIP-seq
MIRT1181603	hsa-miR-4674	CLIP-seq
MIRT2052583	hsa-miR-509-3-5p	CLIP-seq
MIRT2052584	hsa-miR-509-5p	CLIP-seq
MIRT1181619	hsa-miR-544b	CLIP-seq
MIRT1181624	hsa-miR-608	CLIP-seq
MIRT2281948	hsa-miR-628-5p	CLIP-seq
MIRT1181635	hsa-miR-92a	CLIP-seq
MIRT1181636	hsa-miR-92b	CLIP-seq
MIRT2391509	hsa-miR-197	CLIP-seq
MIRT2391510	hsa-miR-29a	CLIP-seq
MIRT2391511	hsa-miR-29b	CLIP-seq
MIRT2391512	hsa-miR-29c	CLIP-seq
MIRT1181659	hsa-miR-3065-3p	CLIP-seq
MIRT2391513	hsa-miR-3616-3p	CLIP-seq
MIRT2391514	hsa-miR-4436b-3p	CLIP-seq
MIRT2391515	hsa-miR-767-5p	CLIP-seq
MIRT1181657	hsa-miR-1976	CLIP-seq
MIRT1181546	hsa-miR-2114	CLIP-seq
MIRT1181551	hsa-miR-2964a-3p	CLIP-seq
MIRT1181554	hsa-miR-3122	CLIP-seq
MIRT1181565	hsa-miR-3545-3p	CLIP-seq
MIRT2052559	hsa-miR-3613-3p	CLIP-seq
MIRT1181568	hsa-miR-3622a-3p	CLIP-seq
MIRT1181569	hsa-miR-3622b-3p	CLIP-seq
MIRT1181570	hsa-miR-3622b-5p	CLIP-seq
MIRT2052560	hsa-miR-3664-3p	CLIP-seq
MIRT1181575	hsa-miR-3675-3p	CLIP-seq
MIRT1181577	hsa-miR-3689a-3p	CLIP-seq
MIRT1181578	hsa-miR-3689c	CLIP-seq
MIRT1181579	hsa-miR-3689d	CLIP-seq
MIRT1181664	hsa-miR-370	CLIP-seq
MIRT2455076	hsa-miR-371-5p	CLIP-seq
MIRT2455077	hsa-miR-371b-5p	CLIP-seq
MIRT1181581	hsa-miR-3913-5p	CLIP-seq
MIRT1181586	hsa-miR-3929	CLIP-seq
MIRT1181668	hsa-miR-4279	CLIP-seq
MIRT1181669	hsa-miR-4283	CLIP-seq
MIRT1181591	hsa-miR-4419b	CLIP-seq
MIRT1181593	hsa-miR-4433	CLIP-seq
MIRT1181596	hsa-miR-4478	CLIP-seq
MIRT1181672	hsa-miR-4489	CLIP-seq
MIRT1181674	hsa-miR-4645-5p	CLIP-seq
MIRT1181599	hsa-miR-4649-3p	CLIP-seq
MIRT1181675	hsa-miR-4662a-5p	CLIP-seq
MIRT1181677	hsa-miR-4673	CLIP-seq
MIRT1181678	hsa-miR-4676-5p	CLIP-seq
MIRT1181604	hsa-miR-4680-5p	CLIP-seq
MIRT1181605	hsa-miR-4684-5p	CLIP-seq
MIRT1181607	hsa-miR-4728-5p	CLIP-seq
MIRT1181686	hsa-miR-4753-3p	CLIP-seq
MIRT1181687	hsa-miR-4755-3p	CLIP-seq
MIRT1181613	hsa-miR-485-5p	CLIP-seq
MIRT1181614	hsa-miR-510	CLIP-seq
MIRT1181618	hsa-miR-541	CLIP-seq
MIRT1181619	hsa-miR-544b	CLIP-seq
MIRT1181622	hsa-miR-548c-3p	CLIP-seq
MIRT1181712	hsa-miR-575	CLIP-seq
MIRT1181627	hsa-miR-654-5p	CLIP-seq
MIRT1181634	hsa-miR-890	CLIP-seq
MIRT1181657	hsa-miR-1976	CLIP-seq
MIRT1181668	hsa-miR-4279	CLIP-seq
MIRT1181674	hsa-miR-4645-5p	CLIP-seq
MIRT1181677	hsa-miR-4673	CLIP-seq
MIRT1181686	hsa-miR-4753-3p	CLIP-seq
MIRT2052548	hsa-miR-103b	CLIP-seq
MIRT2052549	hsa-miR-1184	CLIP-seq
MIRT2579955	hsa-miR-1200	CLIP-seq
MIRT2579956	hsa-miR-1224-3p	CLIP-seq
MIRT2052550	hsa-miR-1226	CLIP-seq
MIRT2052551	hsa-miR-1227	CLIP-seq
MIRT2579957	hsa-miR-1247	CLIP-seq
MIRT2579958	hsa-miR-1250	CLIP-seq
MIRT2579959	hsa-miR-1252	CLIP-seq
MIRT2579960	hsa-miR-1260	CLIP-seq
MIRT2579961	hsa-miR-1260b	CLIP-seq
MIRT2579962	hsa-miR-1271	CLIP-seq
MIRT1181539	hsa-miR-1273	CLIP-seq
MIRT2579963	hsa-miR-1275	CLIP-seq
MIRT2579964	hsa-miR-1280	CLIP-seq
MIRT2579965	hsa-miR-1285	CLIP-seq
MIRT2579966	hsa-miR-1288	CLIP-seq
MIRT1551734	hsa-miR-1291	CLIP-seq
MIRT2579967	hsa-miR-1304	CLIP-seq
MIRT2579968	hsa-miR-1323	CLIP-seq
MIRT2579969	hsa-miR-153	CLIP-seq
MIRT2579970	hsa-miR-1587	CLIP-seq
MIRT2579971	hsa-miR-186	CLIP-seq
MIRT1181545	hsa-miR-1915	CLIP-seq
MIRT2579972	hsa-miR-193a-3p	CLIP-seq
MIRT2579973	hsa-miR-193b	CLIP-seq
MIRT1181657	hsa-miR-1976	CLIP-seq
MIRT2579974	hsa-miR-208a	CLIP-seq
MIRT2579975	hsa-miR-208b	CLIP-seq
MIRT1181546	hsa-miR-2114	CLIP-seq
MIRT2052555	hsa-miR-2277-3p	CLIP-seq
MIRT1181548	hsa-miR-24	CLIP-seq
MIRT1181550	hsa-miR-2861	CLIP-seq
MIRT1181551	hsa-miR-2964a-3p	CLIP-seq
MIRT1181639	hsa-miR-298	CLIP-seq
MIRT2052557	hsa-miR-3064-3p	CLIP-seq
MIRT1181552	hsa-miR-3064-5p	CLIP-seq
MIRT1181554	hsa-miR-3122	CLIP-seq
MIRT2579976	hsa-miR-3133	CLIP-seq
MIRT2579977	hsa-miR-3138	CLIP-seq
MIRT2579978	hsa-miR-3151	CLIP-seq
MIRT1181559	hsa-miR-3154	CLIP-seq
MIRT2579979	hsa-miR-3160-3p	CLIP-seq
MIRT2579980	hsa-miR-3176	CLIP-seq
MIRT2579981	hsa-miR-3183	CLIP-seq
MIRT2579982	hsa-miR-3185	CLIP-seq
MIRT2579983	hsa-miR-3187-3p	CLIP-seq
MIRT2579984	hsa-miR-3194-3p	CLIP-seq
MIRT2579985	hsa-miR-3199	CLIP-seq
MIRT2579986	hsa-miR-3200-5p	CLIP-seq
MIRT2579987	hsa-miR-3202	CLIP-seq
MIRT1181563	hsa-miR-323-5p	CLIP-seq
MIRT2579988	hsa-miR-340	CLIP-seq
MIRT1181564	hsa-miR-342-5p	CLIP-seq
MIRT2579989	hsa-miR-34a	CLIP-seq
MIRT2579990	hsa-miR-34c-5p	CLIP-seq
MIRT1181565	hsa-miR-3545-3p	CLIP-seq
MIRT2579991	hsa-miR-3591-3p	CLIP-seq
MIRT2052559	hsa-miR-3613-3p	CLIP-seq
MIRT1181661	hsa-miR-3616-5p	CLIP-seq
MIRT2579992	hsa-miR-3617	CLIP-seq
MIRT1181568	hsa-miR-3622a-3p	CLIP-seq
MIRT1181569	hsa-miR-3622b-3p	CLIP-seq
MIRT1181570	hsa-miR-3622b-5p	CLIP-seq
MIRT1181662	hsa-miR-3647-5p	CLIP-seq
MIRT1181573	hsa-miR-365	CLIP-seq
MIRT1181663	hsa-miR-3652	CLIP-seq
MIRT2579993	hsa-miR-3662	CLIP-seq
MIRT2052560	hsa-miR-3664-3p	CLIP-seq
MIRT2579994	hsa-miR-3672	CLIP-seq
MIRT1181575	hsa-miR-3675-3p	CLIP-seq
MIRT1181577	hsa-miR-3689a-3p	CLIP-seq
MIRT1181578	hsa-miR-3689c	CLIP-seq
MIRT1181579	hsa-miR-3689d	CLIP-seq
MIRT2579995	hsa-miR-3714	CLIP-seq
MIRT2455076	hsa-miR-371-5p	CLIP-seq
MIRT2455077	hsa-miR-371b-5p	CLIP-seq
MIRT1181580	hsa-miR-380	CLIP-seq
MIRT2579996	hsa-miR-383	CLIP-seq
MIRT2579997	hsa-miR-3913-3p	CLIP-seq
MIRT1181581	hsa-miR-3913-5p	CLIP-seq
MIRT1181582	hsa-miR-3918	CLIP-seq
MIRT2579998	hsa-miR-3920	CLIP-seq
MIRT2579999	hsa-miR-3922-3p	CLIP-seq
MIRT1181584	hsa-miR-3924	CLIP-seq
MIRT2580000	hsa-miR-3926	CLIP-seq
MIRT1181586	hsa-miR-3929	CLIP-seq
MIRT2580001	hsa-miR-411	CLIP-seq
MIRT1181588	hsa-miR-4253	CLIP-seq
MIRT2580002	hsa-miR-4261	CLIP-seq
MIRT2052563	hsa-miR-4267	CLIP-seq
MIRT2580003	hsa-miR-4268	CLIP-seq
MIRT1181668	hsa-miR-4279	CLIP-seq
MIRT1181669	hsa-miR-4283	CLIP-seq
MIRT1181589	hsa-miR-4284	CLIP-seq
MIRT2052565	hsa-miR-4287	CLIP-seq
MIRT1181670	hsa-miR-4293	CLIP-seq
MIRT2580004	hsa-miR-4324	CLIP-seq
MIRT1181591	hsa-miR-4419b	CLIP-seq
MIRT1181671	hsa-miR-4430	CLIP-seq
MIRT1181593	hsa-miR-4433	CLIP-seq
MIRT2580005	hsa-miR-4435	CLIP-seq
MIRT2580006	hsa-miR-4436a	CLIP-seq
MIRT2580007	hsa-miR-4447	CLIP-seq
MIRT2580008	hsa-miR-4448	CLIP-seq
MIRT2052570	hsa-miR-4462	CLIP-seq
MIRT2580009	hsa-miR-4470	CLIP-seq
MIRT2580010	hsa-miR-4472	CLIP-seq
MIRT2580011	hsa-miR-4474-3p	CLIP-seq
MIRT1181595	hsa-miR-4476	CLIP-seq
MIRT1181596	hsa-miR-4478	CLIP-seq
MIRT2580012	hsa-miR-448	CLIP-seq
MIRT2580013	hsa-miR-4480	CLIP-seq
MIRT2580014	hsa-miR-4487	CLIP-seq
MIRT1181672	hsa-miR-4489	CLIP-seq
MIRT1181597	hsa-miR-4495	CLIP-seq
MIRT2580015	hsa-miR-4496	CLIP-seq
MIRT2580016	hsa-miR-449a	CLIP-seq
MIRT2580017	hsa-miR-449b	CLIP-seq
MIRT1181598	hsa-miR-4512	CLIP-seq
MIRT2580018	hsa-miR-4530	CLIP-seq
MIRT2580019	hsa-miR-4531	CLIP-seq
MIRT2580020	hsa-miR-4533	CLIP-seq
MIRT2052572	hsa-miR-4537	CLIP-seq
MIRT2580021	hsa-miR-4639-5p	CLIP-seq
MIRT1181674	hsa-miR-4645-5p	CLIP-seq
MIRT1181599	hsa-miR-4649-3p	CLIP-seq
MIRT2580022	hsa-miR-4652-5p	CLIP-seq
MIRT1181675	hsa-miR-4662a-5p	CLIP-seq
MIRT1181601	hsa-miR-4664-5p	CLIP-seq
MIRT2580023	hsa-miR-4665-5p	CLIP-seq
MIRT1181677	hsa-miR-4673	CLIP-seq
MIRT1181603	hsa-miR-4674	CLIP-seq
MIRT1181678	hsa-miR-4676-5p	CLIP-seq
MIRT1181679	hsa-miR-4677-3p	CLIP-seq
MIRT1181680	hsa-miR-4679	CLIP-seq
MIRT1181604	hsa-miR-4680-5p	CLIP-seq
MIRT1181605	hsa-miR-4684-5p	CLIP-seq
MIRT2052575	hsa-miR-4685-3p	CLIP-seq
MIRT2580024	hsa-miR-4690-3p	CLIP-seq
MIRT1181681	hsa-miR-4691-3p	CLIP-seq
MIRT2580025	hsa-miR-4695-3p	CLIP-seq
MIRT2580026	hsa-miR-4701-5p	CLIP-seq
MIRT2580027	hsa-miR-4723-3p	CLIP-seq
MIRT2580028	hsa-miR-4726-3p	CLIP-seq
MIRT2580029	hsa-miR-4727-5p	CLIP-seq
MIRT1181607	hsa-miR-4728-5p	CLIP-seq
MIRT1181647	hsa-miR-4744	CLIP-seq
MIRT2052579	hsa-miR-4746-3p	CLIP-seq
MIRT1181686	hsa-miR-4753-3p	CLIP-seq
MIRT1181687	hsa-miR-4755-3p	CLIP-seq
MIRT2580030	hsa-miR-4772-5p	CLIP-seq
MIRT2580031	hsa-miR-4780	CLIP-seq
MIRT2580032	hsa-miR-4786-3p	CLIP-seq
MIRT1181611	hsa-miR-4786-5p	CLIP-seq
MIRT2580033	hsa-miR-4790-3p	CLIP-seq
MIRT2580034	hsa-miR-4790-5p	CLIP-seq
MIRT2052580	hsa-miR-4792	CLIP-seq
MIRT1181689	hsa-miR-4802-3p	CLIP-seq
MIRT1181613	hsa-miR-485-5p	CLIP-seq
MIRT2580035	hsa-miR-491-5p	CLIP-seq
MIRT2580036	hsa-miR-499-5p	CLIP-seq
MIRT2052581	hsa-miR-499a-5p	CLIP-seq
MIRT1181614	hsa-miR-510	CLIP-seq
MIRT2580037	hsa-miR-513c	CLIP-seq
MIRT2580038	hsa-miR-514b-5p	CLIP-seq
MIRT2580039	hsa-miR-515-5p	CLIP-seq
MIRT2580040	hsa-miR-526b	CLIP-seq
MIRT2580041	hsa-miR-532-3p	CLIP-seq
MIRT1181618	hsa-miR-541	CLIP-seq
MIRT1181619	hsa-miR-544b	CLIP-seq
MIRT1181696	hsa-miR-548aa	CLIP-seq
MIRT1181622	hsa-miR-548c-3p	CLIP-seq
MIRT2580042	hsa-miR-548o	CLIP-seq
MIRT2580043	hsa-miR-548s	CLIP-seq
MIRT1181707	hsa-miR-550a	CLIP-seq
MIRT2580044	hsa-miR-556-5p	CLIP-seq
MIRT2580045	hsa-miR-558	CLIP-seq
MIRT1181711	hsa-miR-573	CLIP-seq
MIRT1181712	hsa-miR-575	CLIP-seq
MIRT2580046	hsa-miR-588	CLIP-seq
MIRT2580047	hsa-miR-595	CLIP-seq
MIRT2580048	hsa-miR-617	CLIP-seq
MIRT1181625	hsa-miR-622	CLIP-seq
MIRT2580049	hsa-miR-623	CLIP-seq
MIRT2580050	hsa-miR-641	CLIP-seq
MIRT1181627	hsa-miR-654-5p	CLIP-seq
MIRT1181632	hsa-miR-766	CLIP-seq
MIRT2580051	hsa-miR-767-3p	CLIP-seq
MIRT2580052	hsa-miR-769-5p	CLIP-seq
MIRT1181633	hsa-miR-876-3p	CLIP-seq
MIRT1181634	hsa-miR-890	CLIP-seq
MIRT2580053	hsa-miR-892b	CLIP-seq
MIRT2580054	hsa-miR-9	CLIP-seq
MIRT2580055	hsa-miR-922	CLIP-seq
MIRT2580056	hsa-miR-96	CLIP-seq
MIRT2455077	hsa-miR-371b-5p	CLIP-seq
MIRT2052548	hsa-miR-103b	CLIP-seq
MIRT2052550	hsa-miR-1226	CLIP-seq
MIRT2579957	hsa-miR-1247	CLIP-seq
MIRT2579958	hsa-miR-1250	CLIP-seq
MIRT2579959	hsa-miR-1252	CLIP-seq
MIRT2579962	hsa-miR-1271	CLIP-seq
MIRT1181539	hsa-miR-1273	CLIP-seq
MIRT2579963	hsa-miR-1275	CLIP-seq
MIRT2579965	hsa-miR-1285	CLIP-seq
MIRT2579966	hsa-miR-1288	CLIP-seq
MIRT1551734	hsa-miR-1291	CLIP-seq
MIRT2579967	hsa-miR-1304	CLIP-seq
MIRT2579968	hsa-miR-1323	CLIP-seq
MIRT2579969	hsa-miR-153	CLIP-seq
MIRT2579970	hsa-miR-1587	CLIP-seq
MIRT2579971	hsa-miR-186	CLIP-seq
MIRT1181545	hsa-miR-1915	CLIP-seq
MIRT2579972	hsa-miR-193a-3p	CLIP-seq
MIRT2579973	hsa-miR-193b	CLIP-seq
MIRT2579974	hsa-miR-208a	CLIP-seq
MIRT2579975	hsa-miR-208b	CLIP-seq
MIRT1181546	hsa-miR-2114	CLIP-seq
MIRT2052555	hsa-miR-2277-3p	CLIP-seq
MIRT1181548	hsa-miR-24	CLIP-seq
MIRT1181551	hsa-miR-2964a-3p	CLIP-seq
MIRT1181639	hsa-miR-298	CLIP-seq
MIRT2052557	hsa-miR-3064-3p	CLIP-seq
MIRT1181552	hsa-miR-3064-5p	CLIP-seq
MIRT1181554	hsa-miR-3122	CLIP-seq
MIRT2579976	hsa-miR-3133	CLIP-seq
MIRT2579978	hsa-miR-3151	CLIP-seq
MIRT1181559	hsa-miR-3154	CLIP-seq
MIRT2579979	hsa-miR-3160-3p	CLIP-seq
MIRT2579980	hsa-miR-3176	CLIP-seq
MIRT2579982	hsa-miR-3185	CLIP-seq
MIRT2686215	hsa-miR-3189-3p	CLIP-seq
MIRT2579984	hsa-miR-3194-3p	CLIP-seq
MIRT2579985	hsa-miR-3199	CLIP-seq
MIRT2579986	hsa-miR-3200-5p	CLIP-seq
MIRT2579987	hsa-miR-3202	CLIP-seq
MIRT2579988	hsa-miR-340	CLIP-seq
MIRT2579989	hsa-miR-34a	CLIP-seq
MIRT2579990	hsa-miR-34c-5p	CLIP-seq
MIRT2579991	hsa-miR-3591-3p	CLIP-seq
MIRT2052559	hsa-miR-3613-3p	CLIP-seq
MIRT2579992	hsa-miR-3617	CLIP-seq
MIRT1181568	hsa-miR-3622a-3p	CLIP-seq
MIRT1181569	hsa-miR-3622b-3p	CLIP-seq
MIRT1181570	hsa-miR-3622b-5p	CLIP-seq
MIRT1181663	hsa-miR-3652	CLIP-seq
MIRT2579993	hsa-miR-3662	CLIP-seq
MIRT2579994	hsa-miR-3672	CLIP-seq
MIRT1181575	hsa-miR-3675-3p	CLIP-seq
MIRT1181577	hsa-miR-3689a-3p	CLIP-seq
MIRT1181578	hsa-miR-3689c	CLIP-seq
MIRT1181579	hsa-miR-3689d	CLIP-seq
MIRT2579995	hsa-miR-3714	CLIP-seq
MIRT2455076	hsa-miR-371-5p	CLIP-seq
MIRT2455077	hsa-miR-371b-5p	CLIP-seq
MIRT2579996	hsa-miR-383	CLIP-seq
MIRT2579997	hsa-miR-3913-3p	CLIP-seq
MIRT1181581	hsa-miR-3913-5p	CLIP-seq
MIRT2579998	hsa-miR-3920	CLIP-seq
MIRT2579999	hsa-miR-3922-3p	CLIP-seq
MIRT2580000	hsa-miR-3926	CLIP-seq
MIRT1181586	hsa-miR-3929	CLIP-seq
MIRT2580001	hsa-miR-411	CLIP-seq
MIRT1181588	hsa-miR-4253	CLIP-seq
MIRT2686216	hsa-miR-4260	CLIP-seq
MIRT2580002	hsa-miR-4261	CLIP-seq
MIRT2052563	hsa-miR-4267	CLIP-seq
MIRT1181669	hsa-miR-4283	CLIP-seq
MIRT1181589	hsa-miR-4284	CLIP-seq
MIRT2052565	hsa-miR-4287	CLIP-seq
MIRT1181670	hsa-miR-4293	CLIP-seq
MIRT2580004	hsa-miR-4324	CLIP-seq
MIRT1181591	hsa-miR-4419b	CLIP-seq
MIRT1181671	hsa-miR-4430	CLIP-seq
MIRT2580006	hsa-miR-4436a	CLIP-seq
MIRT2686217	hsa-miR-4446-3p	CLIP-seq
MIRT2580007	hsa-miR-4447	CLIP-seq
MIRT2052570	hsa-miR-4462	CLIP-seq
MIRT2580009	hsa-miR-4470	CLIP-seq
MIRT2580010	hsa-miR-4472	CLIP-seq
MIRT2580011	hsa-miR-4474-3p	CLIP-seq
MIRT1181595	hsa-miR-4476	CLIP-seq
MIRT1181596	hsa-miR-4478	CLIP-seq
MIRT2580012	hsa-miR-448	CLIP-seq
MIRT2580014	hsa-miR-4487	CLIP-seq
MIRT1181672	hsa-miR-4489	CLIP-seq
MIRT2580015	hsa-miR-4496	CLIP-seq
MIRT2580016	hsa-miR-449a	CLIP-seq
MIRT2580017	hsa-miR-449b	CLIP-seq
MIRT2580018	hsa-miR-4530	CLIP-seq
MIRT2580019	hsa-miR-4531	CLIP-seq
MIRT2580020	hsa-miR-4533	CLIP-seq
MIRT2052572	hsa-miR-4537	CLIP-seq
MIRT2580021	hsa-miR-4639-5p	CLIP-seq
MIRT1181674	hsa-miR-4645-5p	CLIP-seq
MIRT1181599	hsa-miR-4649-3p	CLIP-seq
MIRT2580022	hsa-miR-4652-5p	CLIP-seq
MIRT1181675	hsa-miR-4662a-5p	CLIP-seq
MIRT2580023	hsa-miR-4665-5p	CLIP-seq
MIRT1181677	hsa-miR-4673	CLIP-seq
MIRT1181603	hsa-miR-4674	CLIP-seq
MIRT1181678	hsa-miR-4676-5p	CLIP-seq
MIRT1181679	hsa-miR-4677-3p	CLIP-seq
MIRT1181680	hsa-miR-4679	CLIP-seq
MIRT1181605	hsa-miR-4684-5p	CLIP-seq
MIRT2052575	hsa-miR-4685-3p	CLIP-seq
MIRT2686218	hsa-miR-4685-5p	CLIP-seq
MIRT2580024	hsa-miR-4690-3p	CLIP-seq
MIRT2580025	hsa-miR-4695-3p	CLIP-seq
MIRT2580028	hsa-miR-4726-3p	CLIP-seq
MIRT2580029	hsa-miR-4727-5p	CLIP-seq
MIRT1181607	hsa-miR-4728-5p	CLIP-seq
MIRT1181647	hsa-miR-4744	CLIP-seq
MIRT2052579	hsa-miR-4746-3p	CLIP-seq
MIRT1181686	hsa-miR-4753-3p	CLIP-seq
MIRT1181687	hsa-miR-4755-3p	CLIP-seq
MIRT2686219	hsa-miR-4761-5p	CLIP-seq
MIRT2580030	hsa-miR-4772-5p	CLIP-seq
MIRT2580031	hsa-miR-4780	CLIP-seq
MIRT1181611	hsa-miR-4786-5p	CLIP-seq
MIRT2580033	hsa-miR-4790-3p	CLIP-seq
MIRT2580034	hsa-miR-4790-5p	CLIP-seq
MIRT2052580	hsa-miR-4792	CLIP-seq
MIRT1181689	hsa-miR-4802-3p	CLIP-seq
MIRT1181613	hsa-miR-485-5p	CLIP-seq
MIRT2686220	hsa-miR-486-3p	CLIP-seq
MIRT2580035	hsa-miR-491-5p	CLIP-seq
MIRT2580036	hsa-miR-499-5p	CLIP-seq
MIRT2052581	hsa-miR-499a-5p	CLIP-seq
MIRT2686221	hsa-miR-502-5p	CLIP-seq
MIRT2580037	hsa-miR-513c	CLIP-seq
MIRT2580038	hsa-miR-514b-5p	CLIP-seq
MIRT2580039	hsa-miR-515-5p	CLIP-seq
MIRT2580040	hsa-miR-526b	CLIP-seq
MIRT1181618	hsa-miR-541	CLIP-seq
MIRT1181619	hsa-miR-544b	CLIP-seq
MIRT1181696	hsa-miR-548aa	CLIP-seq
MIRT1181622	hsa-miR-548c-3p	CLIP-seq
MIRT2580042	hsa-miR-548o	CLIP-seq
MIRT2580043	hsa-miR-548s	CLIP-seq
MIRT1181707	hsa-miR-550a	CLIP-seq
MIRT2580044	hsa-miR-556-5p	CLIP-seq
MIRT2580045	hsa-miR-558	CLIP-seq
MIRT1181712	hsa-miR-575	CLIP-seq
MIRT2580048	hsa-miR-617	CLIP-seq
MIRT1181625	hsa-miR-622	CLIP-seq
MIRT2580049	hsa-miR-623	CLIP-seq
MIRT2580050	hsa-miR-641	CLIP-seq
MIRT1181627	hsa-miR-654-5p	CLIP-seq
MIRT1181632	hsa-miR-766	CLIP-seq
MIRT2580051	hsa-miR-767-3p	CLIP-seq
MIRT2580052	hsa-miR-769-5p	CLIP-seq
MIRT1181634	hsa-miR-890	CLIP-seq
MIRT2580053	hsa-miR-892b	CLIP-seq
MIRT2580054	hsa-miR-9	CLIP-seq
MIRT2580055	hsa-miR-922	CLIP-seq
MIRT2580056	hsa-miR-96	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001726	Component	Ruffle	IEA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	TAS	17210637
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0005178	Function	Integrin binding	IBA
GO:0005515	Function	Protein binding	IPI	9430655, 9537418, 10669747, 10861283, 11779178, 15467741, 16885985, 17210637, 17242191, 17509819, 19144871, 19615732, 20178741, 20890305, 21167305, 21481793, 23414517, 23455924, 24012335, 24366813, 24981860, 25706233, 29997244, 31467278, 32296183, 32814053, 33961781, 37398436
GO:0005634	Component	Nucleus	IDA	10401006, 20178741
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA	9537418
GO:0005737	Component	Cytoplasm	IDA	9537418
GO:0005737	Component	Cytoplasm	IEA
GO:0005769	Component	Early endosome	IDA	10861283
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	8379998
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10401006
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IEA
GO:0007398	Process	Ectoderm development	IEA
GO:0007420	Process	Brain development	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	12444102, 20178741
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17210637
GO:0008360	Process	Regulation of cell shape	IBA
GO:0010626	Process	Negative regulation of Schwann cell proliferation	IEA
GO:0014010	Process	Schwann cell proliferation	IEA
GO:0014010	Process	Schwann cell proliferation	IMP	17353411
GO:0014013	Process	Regulation of gliogenesis	IBA
GO:0014013	Process	Regulation of gliogenesis	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IDA	17210637
GO:0030027	Component	Lamellipodium	IEA
GO:0030036	Process	Actin cytoskeleton organization	IMP	9537418
GO:0030154	Process	Cell differentiation	IEA
GO:0030175	Component	Filopodium	IBA
GO:0030175	Component	Filopodium	IEA
GO:0030336	Process	Negative regulation of cell migration	TAS	17210637
GO:0030864	Component	Cortical actin cytoskeleton	IEA
GO:0031527	Component	Filopodium membrane	IEA
GO:0031647	Process	Regulation of protein stability	IEA
GO:0032154	Component	Cleavage furrow	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0033687	Process	Osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0035330	Process	Regulation of hippo signaling	IBA
GO:0035330	Process	Regulation of hippo signaling	IMP	20159598
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042981	Process	Regulation of apoptotic process	IMP	21167305
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0044297	Component	Cell body	IEA
GO:0045177	Component	Apical part of cell	IBA
GO:0045177	Component	Apical part of cell	IEA
GO:0045216	Process	Cell-cell junction organization	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IDA	12444102
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17210637
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	9537418
GO:0051726	Process	Regulation of cell cycle	IMP	21167305
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0072091	Process	Regulation of stem cell proliferation	IEA
GO:1900180	Process	Regulation of protein localization to nucleus	IEA
GO:1902115	Process	Regulation of organelle assembly	IBA
GO:1902966	Process	Positive regulation of protein localization to early endosome	IBA
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA
GO:2000643	Process	Positive regulation of early endosome to late endosome transport	IBA

Other IDs

• MIM: 607379
• HGNC: 7773
• e!Ensembl: ENSG00000186575

Protein

• UniProt ID: P35240
• Protein name: Merlin (Moesin-ezrin-radixin-like protein) (Neurofibromin-2) (Schwannomerlin) (Schwannomin)
• Protein function: Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphor
• PDB: 1H4R, 3U8Z, 4ZRI, 4ZRJ, 6CDS, 7LWH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09379	FERM_N	26 → 87	FERM N-terminal domain	Domain
  PF00373	FERM_M	105 → 222	FERM central domain	Domain
  PF09380	FERM_C	226 → 315	FERM C-terminal PH-like domain	Domain
  PF00769	ERM	347 → 595	Ezrin/radixin/moesin family	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Isoform 1 and isoform 3 are predominant. Isoform 4, isoform 5 and isoform 6 are expressed moderately. Isoform 8 is found at low frequency. Isoform 7, isoform 9 and isoform 10 are not expressed in adult tissues, with t
• Sequence:

  MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
  FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
  QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
  PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
  LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
  IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
  LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
  EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
  YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
  ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL

• Sequence length: 595

Pathways

KEGG:

Hippo signaling pathway
Hippo signaling pathway - multiple species
Tight junction

Reactome:

Regulation of actin dynamics for phagocytic cup formation
RHO GTPases activate PAKs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acoustic neuroma	Likely pathogenic; Pathogenic	rs587776562	RCV005251017	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cervical cancer	Likely pathogenic	rs2065657938	RCV005910934	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cholangiocarcinoma	Pathogenic	rs2147053345, rs1555994854	RCV005924025 RCV005939437	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Clear cell carcinoma of kidney	Pathogenic; Likely pathogenic	rs2146869427, rs1555993352	RCV005912643 RCV005925358	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ependymoma	Likely pathogenic	rs1555993293	RCV000577850	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial meningioma	Likely pathogenic; Pathogenic	rs1555993352, rs2066581489	RCV003471525 RCV001195834	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary cancer-predisposing syndrome	Likely pathogenic; Pathogenic	rs2146873271, rs2147122581, rs2146990737, rs2147122623, rs2147010427, rs1555993352, rs2147082680, rs1555992948, rs149803133, rs1569295916, rs2147009482, rs2518646448, rs2147083582, rs2518712644, rs2518665337, rs2147122288, rs587776562, rs121434259, rs74315497, rs2518711603, rs74315499, rs74315504, rs794728682, rs2518680598, rs780880330, rs878853925, rs2147107697, rs2518225830, rs2146966216, rs2518546071, rs74315500, rs1181051479, rs2518709539, rs1555994854, rs1064796632, rs1555993345, rs1555993336, rs1556003799, rs1601618646, rs1601612044, rs1556003801, rs2067131272	RCV002460151 RCV003284294 RCV002361006 RCV003289307 RCV005684854 RCV002258342 RCV004044907 RCV002335101 RCV002359628 RCV002360227 RCV002385149 RCV002387222 RCV002387232 RCV002390028 RCV002387573 RCV002392626 RCV005372224 RCV002399307 RCV004018546 RCV002396774 RCV003278654 RCV002390087 RCV002415775 RCV005455631 RCV003187959 RCV002399811 RCV003297509 RCV003297520 RCV003283478 RCV003297521 RCV003339261 RCV003339266 RCV004368995 RCV004523219 RCV004943926 RCV005372350 RCV003278880 RCV002358461 RCV002404386 RCV004027573 RCV005453103 RCV002451214 RCV005384932 RCV004033567	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Pathogenic; Likely pathogenic	rs587776563, rs121434259, rs74315496, rs1555987732, rs2065661533, rs780880330, rs2066859618	RCV000003445 RCV000003446 RCV005647960 RCV005648036 RCV006254196 RCV005648109 RCV005648106	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mesothelioma	Pathogenic; Likely pathogenic	rs2147007533, rs2146869444, rs2065657938	RCV005930328 RCV005928657 RCV005910933	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs1064796632, rs1569293373	RCV005230951 RCV005231304	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurofibromatosis, type 2	Likely pathogenic; Pathogenic	rs2066373952, rs2146661259, rs2146873271, rs2146990961, rs2146854993, rs2146869427, rs2146871865, rs2146892921, rs2146966417, rs1303879665, rs2146990314, rs2147082728, rs2147122581, rs2147122741, rs2147010188, rs2146966216, rs2146895235, rs2147108214, rs2147091894, rs2147122795, rs2146871313, rs2146989887, rs2146966294, rs2147052253, rs2147122623, rs2147084279, rs2147072473, rs2146854677, rs2147073084, rs2146894926, rs2147071740, rs992662337, rs2066864084, rs2146974102, rs2147082167, rs2147107697, rs1601583839, rs2146966211, rs2147010427, rs1350177470, rs1555993352, rs2147051643, rs2147083330, rs2147053345, rs2147082680, rs2147033768, rs2146972508, rs74315492, rs587776562, rs121434259, rs74315493, rs74315494, rs74315495, rs74315496, rs74315497, rs74315499, rs74315501, rs74315503, rs74315504, rs74315505, rs2147072145, rs2066248439, rs2518545485, rs2518436090, rs2147007533, rs2147011325, rs74315498, rs2518713830, rs2518734591, rs794728682, rs2518714056, rs1026724985, rs2518545794, rs2146869444, rs2518664935, rs2518712946, rs2518465594, rs2518575127, rs2518680598, rs2518556881, rs2518435287, rs878853925, rs1350618734, rs2518681643, rs2518667376, rs2518664988, rs2518709539, rs2518623181, rs1302428933, rs2518228232, rs2146853282, rs1006294051, rs2518680037, rs2518714042, rs1556003799, rs2518598543, rs2518665323, rs2518225875, rs2146967302, rs2518646706, rs2518436718, rs2518712770, rs2518575579, rs2518575597, rs2146851519, rs2518734000, rs2518713289, rs1060503667, rs1060503670, rs1060503666, rs1064796632, rs1556000842, rs1555986860, rs1556001351, rs1555993345, rs1555994819, rs1555993336, rs1555987647, rs1555978356, rs780872661, rs917257652, rs1555998851, rs1555993313, rs1555978369, rs1555987732, rs1555992948, rs1555993301, rs1556002457, rs1556002536, rs1556003801, rs1569293488, rs1569302393, rs1555994854, rs1569304774, rs1601515970, rs1601618646, rs1601643866, rs1601649018, rs1601666156, rs1601666191, rs1601612044, rs1601652425, rs1601613230, rs1601579095, rs1601579295, rs1601611973, rs1601618501, rs1601624078, rs1601624296, rs1601636894, rs1601644146, rs1601648452, rs1601649049, rs1601643896, rs2065661533, rs2065728187, rs2065831369, rs2066861383, rs2066580454, rs1418675250, rs780880330, rs2064715459, rs2066466759, rs2066859618, rs2066915159, rs2067131272, rs2064712705, rs2065731921, rs2065731800, rs2065832124, rs2065831600, rs2146966685, rs2147122655, rs2065657938, rs2066914171, rs2065661430	RCV001332327 RCV001379500 RCV001378942 RCV001378450 RCV001385347 RCV001385348 RCV001388309 RCV001381495 RCV001388204 RCV001387668 RCV001382466 RCV001390135 RCV001388575 RCV001388709 RCV001725924 RCV004594587 RCV001784745 RCV001799568 RCV001923927 RCV001863771 RCV001866366 RCV001999877 RCV001939432 RCV001946715 RCV001949289 RCV001958855 RCV002010890 RCV001874499 RCV002007362 RCV002035270 RCV001994625 RCV002007543 RCV001953494 RCV001951002 RCV001942281 RCV001942282 RCV001942285 RCV001931561 RCV001953922 RCV001972706 RCV001938986 RCV001947008 RCV001947042 RCV001959062 RCV001889215 RCV002071030 RCV002250145 RCV002272757 RCV000003443 RCV000003444 RCV000660130 RCV000003447 RCV000003448 RCV000003450 RCV000003451 RCV000003452 RCV000003453 RCV000003454 RCV000003455 RCV000003456 RCV000003457 RCV002466766 RCV002466770 RCV002466782 RCV003041409 RCV003064648 RCV003050578 RCV003064649 RCV003064650 RCV003064651 RCV001852320 RCV002806826 RCV002811880 RCV002847722 RCV002863743 RCV002894148 RCV002871726 RCV002871852 RCV002858478 RCV002933098 RCV003038889 RCV003041948 RCV000232701 RCV003314351 RCV003500968 RCV003500940 RCV003501044 RCV003501252 RCV003501939 RCV003501746 RCV003501747 RCV003501748 RCV003501749 RCV003501751 RCV003501752 RCV003501753 RCV003500180 RCV003500457 RCV003607969 RCV003607944 RCV003608087 RCV003608146 RCV003608147 RCV003608190 RCV003608331 RCV003608427 RCV004016202 RCV005100816 RCV000462897 RCV000458184 RCV000468441 RCV001202383 RCV005091057 RCV000811191 RCV000528431 RCV000533078 RCV000543560 RCV000531744 RCV000554782 RCV000537390 RCV000560397 RCV000582954 RCV000581833 RCV000632637 RCV000632647 RCV000632648 RCV000660129 RCV000660131 RCV000660132 RCV000660133 RCV000660134 RCV000660135 RCV000660137 RCV000685495 RCV000707217 RCV000700491 RCV000687576 RCV000798498 RCV000796728 RCV000793709 RCV000822317 RCV000816884 RCV000804920 RCV000801012 RCV000823189 RCV000810194 RCV000990406 RCV000990407 RCV000990409 RCV000990411 RCV000990412 RCV000990413 RCV000990414 RCV000990416 RCV000990417 RCV000990418 RCV003500611 RCV001071089 RCV001067490 RCV001060499 RCV001069043 RCV001052619 RCV001069943 RCV001090178 RCV001862673 RCV001216099 RCV001208229 RCV001206494 RCV001210735 RCV001204813 RCV001203312 RCV001236380 RCV001228183 RCV001245794 RCV001245028 RCV001237903 RCV001280884 RCV001523832 RCV001523833 RCV001293486 RCV001294063 RCV001303321	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NF2-related disorder	Pathogenic; Likely pathogenic	rs2065831369, rs587776562	RCV003413876 RCV003414039	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SMARCB1-related schwannomatosis	Pathogenic; Likely pathogenic	rs2146966216, rs587776564, rs587776565, rs2518679943, rs2147084279, rs1601583839	RCV002466695 RCV000003460 RCV000003461 RCV003326214 RCV003448541 RCV002272353	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Spindle cell sarcoma	Pathogenic	rs1569294187	RCV000714280	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Autosomal dominant polycystic liver disease	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bilateral vestibular schwannoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Choroid plexus carcinoma	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of nervous system	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of breast	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENINGIOMA, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENINGIOMA, FAMILIAL, SUSCEPTIBILITY TO	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROFIBROMATOSIS 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROFIBROMATOSIS TYPE 2	—	ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis, type 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHWANNOMATOSIS, VESTIBULAR	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	11380622, 12011146, 12646839, 15639530, 16436990, 16436992, 16857415, 17989580, 18199958, 18199961, 18839347, 19772601, 19943731, 20600642, 20729918, 20831745, 20872275, 22295085, 23377185, 23921927, 24619252, 26049313, 27755359, 28265819, 28283837, 28710469, 29902598, 30274821, 30325044, 30624408, 30953268, 31789805, 7911002, 7951231, 8004107, 8557252, 8559307, 8622160, 9100669, 9473065, 9635681, 9643284, 9674507		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acoustic Neuroma	Acoustic Neuroma	LHGDN	18173316		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acoustic Neuroma	Acoustic Neuroma	GENOMICS_ENGLAND_DG	23788249		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acute leukemia	Leukemia	BEFREE	22081132		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11996670, 16142420		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30282520		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	8741802		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25490274	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia, Transient Global	Amnesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12761036		★☆☆☆☆ Found in Text Mining only
Angioblastic Meningioma	Angioblastic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Angiomatous Meningioma	Angiomatous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	17505464		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17505464		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11996787, 21383154, 8261460		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	25333347, 31822682	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	18087273, 24892285		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37264476	Associate	★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	11147878, 19148485, 26840621		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	15837555, 17989580, 21647202, 21800959, 23776562, 26049313, 26549023, 9679758		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	BEFREE	11779178		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	37341068	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11844817		★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	19687056		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10736068, 12444102, 16497727, 7657387, 9083553		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24767714	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15467753, 21965655, 26908451, 28112165, 29893810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26908451	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28112165, 29893810, 35064101, 37080959, 7493911	Associate	★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17509660, 17962031, 20195187, 24980480, 26443326, 30417500, 34261524	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20179190	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	31151928	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26443326, 33818013, 36920600	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11844817		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22081132, 7882313		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20054297, 26494726, 32217839, 35122417, 35971742, 36917021, 36975468	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39788204	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16824698		★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	BEFREE	24421319		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	18976311, 8751853	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	12665675, 17509660, 21383154, 29130106, 8559307, 8655145		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	17509660, 23592488, 27229317, 38139220, 7911002	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Convexity Meningioma	Cerebral Convexity Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Clear Cell Meningioma	Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28789444		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10705390, 16082381, 21829229, 22081132, 22391039, 24323642, 30282520, 8069299		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21829229, 30730459, 30816526, 32196591	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	7497438		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	1669691, 22355270		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28849072		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22081132		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	23377185		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	24443315, 32190165	Stimulate	★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	33197677	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative brain disorder	Degenerative Brain Disorder	BEFREE	8172940		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28236056		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	33197677	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19143812		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21698157, 23282078		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27260547		★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	18976311	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28071680		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28071680	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	10433955, 10584875, 11063814, 11996787, 12011257, 15731777, 20491622, 21647202, 22821509, 22912849, 23318455, 24259290, 24357459, 24612193, 25217104, 26549023, 28692055, 7657387, 8261460, 8655145, 8700556, 8805149, 8889505, 9100669		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ependymoma	Ependymoma	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Epiretinal Membrane	Epiretinal Membrane	HPO_DG			★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28298069		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28298069		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	8102569		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	40069121	Associate	★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fallopian Tube Carcinoma	Fallopian Tube Carcinoma	BEFREE	12082455		★☆☆☆☆ Found in Text Mining only
Familial Acoustic Neuroma	Acoustic Neuroma	CTD_human_DG	12136076		★☆☆☆☆ Found in Text Mining only
Familial meningioma	Meningioma	BEFREE	9488313		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial meningioma	Meningioma	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fibrous Meningioma	Fibrous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	11123422, 14562282, 18822692, 21971708		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	11123422	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	18822692		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21167305, 25043298, 25217104, 27345717, 28692055		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23308224, 24503545, 27345717, 28764788	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21167305, 25043298, 25217104, 27345717, 28692055		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15580288, 18632626		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15837555		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	2105641	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28764788, 40355925, 7706208	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	34128073	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12727986		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	33197677	Stimulate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	37904024, 7666400	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	35729665	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioblastic Meningioma	Hemangioblastic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Hemangiopericytic Meningioma	Hemangiopericytic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	7485407		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	8741802		★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	22081132		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	8172940, 8687191		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypothalamic hypothyroidism	Hypothalamic hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16721359		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	15569837		★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29130106		★☆☆☆☆ Found in Text Mining only
Intraorbital Meningioma	Intraorbital Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Intraventricular Meningioma	Intraventricular Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	26494726, 36917021	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24236197	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8102569		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	28801450	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22869869		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	8741802		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11592940, 25113254, 26443326, 29130106		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38060494	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31257748	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9538131		★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	10214350, 12168054, 12673723, 16652148, 19451229, 21615608, 22329991, 29587439, 31567203		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	23435014, 26463840, 26678224, 26928227, 29112861		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	31570769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	12356905		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21965655, 26806348, 26908451, 28112165, 29893810, 7493911		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28071680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28298069		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31063758		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29130106		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22081132, 7882313		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16824698		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11205287, 23541585, 26908451, 29157102		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18361411, 25893302, 28901516		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11844817		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10214350, 10705390, 12082543, 12116319, 15743831, 16824698, 17210637, 19451229, 20491622, 21615608, 21965655, 22081132, 24003252, 24393766, 24848258, 25893302, 26908451, 28468780, 28789444, 28919412, 29130106, 31063758, 31567203, 31730023, 7479897, 7882313, 8630973		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21965655, 26908451, 7493911		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29637450		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22912849, 8655145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	27708104, 30791119, 35100440	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	UNIPROT_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	10214350, 10327069, 10389885, 10462524, 10517503, 10589772, 10606247, 10736068, 10888600, 10901233, 11085592, 11132929, 11147878, 11148074, 11161377, 11205898, 11589430, 11666013, 11668501, 11803467, 12444102, 12544854, 12665675, 12946024, 1336685, 14566860, 15609345, 15645123, 15674477, 16142420, 16398473, 16786152, 16879395, 17083475, 17110285, 17163160, 17222329, 17319281, 17460514, 17509660, 17566081, 17607601, 17721284, 17940085, 18172325, 18474292, 18953429, 19148485, 19451225, 19963129, 20682713, 21175598, 21278391, 21383154, 21529177, 21529178, 21647202, 22195409, 22355270, 22426462, 22912849, 23318455, 23406776, 24171707, 25217104, 25596744, 25857641, 25862935, 25893302, 25965831, 26049897, 26291511, 26549023, 26840621, 27755359, 27871894, 28126595, 28527972, 28552950, 28692055, 29468444, 29660026, 29764516, 29846894, 29852774, 31024808, 31652973, 31715329, 7485407, 7669741, 7717450, 7829212, 7868131, 7911002, 8162072, 8401504, 8413972, 8559307, 8622160, 8655144, 8700556, 8873351, 8880865, 9055299, 9083553, 9100669, 9126902, 9378774, 9408760, 9426397, 9488313, 9635681, 9679758, 9699646, 9852312		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	Pubtator	10517503, 10771486, 12946024, 1496981, 15190457, 15635074, 15779232, 15980114, 16612978, 17222329, 17509660, 18172325, 18808065, 18953429, 19922547, 21383154, 21492294, 22083253, 22355270, 22426462, 22711605, 23334667, 23348505, 23555840, 24171707, 25406210, 25549701, 25993161, 26219339, 27102344, 27548314, 28126595, 28177878, 28193203, 28482067, 28552950, 28610844, 28759666, 28775249, 28923059, 29206892, 29764516, 31470906, 32661686, 32949309, 33068421, 33087175, 33273014, 33622177, 33772057, 34128073, 34495383, 34580720, 35049691, 35178855, 35440040, 35534562, 35568945, 35570314, 35971742, 35986430, 36167400, 36227281, 36288512, 36882706, 36975468, 37014425, 37752594, 39738767, 40004036, 7485407, 7717450, 7911002, 9310240	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	LHGDN	12478663, 12665675, 14566860, 15609345, 15635074, 15980114, 16612978, 16786152, 17478763, 17509660, 18033041, 18953429		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	Pubtator	17962031, 28195122	Inhibit	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	Pubtator	2105641	Stimulate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	CTD_human_DG	23334667		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	ORPHANET_DG	8162072		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	HPO_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	CGI_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningioma	Meningioma	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Meningiomas, Multiple	Meningioma	BEFREE	11979381, 9126902		★☆☆☆☆ Found in Text Mining only
Meningiomas, Multiple	Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Meningothelial meningioma	Meningothelial Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28236056		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	12136076, 12168054, 12802287, 16166281, 16319530, 18835652		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mesothelioma	Mesothelioma	BEFREE	12673723, 14566860, 16652148, 18725387, 23318455, 24786638, 25217104, 27733373, 28692055, 29587439, 30785827, 31231129, 7882313, 8586465, 9022813, 9679758		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mesothelioma	Mesothelioma	Pubtator	12673723, 19451229, 22065079, 25798586, 25823924, 27736841, 31231129, 34531524, 35459788, 37165917, 37295554, 40725095	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mesothelioma	Mesothelioma	LHGDN	12684666, 18725387		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mesothelioma Malignant	Mesothelioma	Pubtator	12673723, 21642991, 21774103, 22825583, 23435014, 25514803, 25902174, 26891694, 27378628, 27813512, 28003305, 29656754, 30417500, 31231129, 32083805, 33493384, 33741915, 33887463, 34648949, 35999269, 39788204, 40725095	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19451229, 25823924	Inhibit	★☆☆☆☆ Found in Text Mining only
Microcystic meningioma	Microcystic Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	35490384	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	19687056		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31523184	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasm of the anterior pituitary	Brain Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasm of the posterior pituitary	Brain Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10214350, 10215625, 10338003, 10394935, 10449091, 10462524, 10561699, 10705390, 10720287, 10736068, 11132929, 11147878, 11159946, 11257108, 11286939, 11290539, 11448944, 11547953, 11666013, 11719502, 11773000, 11779178, 12082543, 12168054, 12203111, 12407444, 12444101, 12444102, 12447105, 12471027, 12566519, 12673723, 12684666, 12946024, 1384671, 14566860, 14580336, 14627667, 14654541, 14679203, 1496981, 15000491, 15378014, 15467753, 15598747, 15609345, 15684865, 15743831, 15835267, 15980976, 16082381, 16324214, 16398470, 16459989, 16652148, 16824698, 16879395, 17210637, 17222254, 17319281, 17442573, 17509660, 17566081, 17868749, 17940085, 17989580, 18072270, 18240308, 18332868, 18361411, 18445079, 18474292, 18593924, 18725387, 18822692, 18829550, 18953429, 19451225, 19451229, 19691769, 19793348, 19963129, 20179190, 20553997, 20600642, 20713513, 20872275, 21072183, 21167305, 21383154, 21529177, 21615608, 21800959, 21965655, 21971708, 22281088, 22295085, 22355270, 22391039, 22426462, 22431917, 22798428, 22821509, 22912849, 23036697, 23318455, 23354516, 23467301, 23565227, 23666797, 24003252, 24259290, 24282279, 24323642, 24450866, 24619252, 24786638, 24912773, 25012216, 25043298, 25113254, 25217104, 25294877, 25490687, 25533176, 25739810, 25893302, 26049313, 26049897, 26066488, 26443326, 26549023, 26549232, 26706012, 26806348, 26908451, 26923924, 26951380, 27259921, 27345717, 27720713, 27793041, 27818180, 27913619, 27958595, 28126595, 28265819, 28283837, 28285878, 28427224, 28566755, 28692055, 28729415, 28885122, 28919412, 29117601, 29130106, 29408605, 29468444, 29626191, 29893810, 30106846, 30143526, 30282520, 30335132, 30624408, 31015291, 31063758, 31063759, 31171721, 31231129, 31296571, 31298338, 31312020, 31523184, 31652973, 31730023, 31789805, 7479897, 7485407, 7493911, 7497438, 7503383, 7579825, 7585559, 7669741, 7828144, 7829260, 7868131, 7911002, 7951231, 8162073, 8261460, 8453669, 8586465, 8622160, 8622873, 8655144, 8655145, 8700556, 8791482, 8805149, 8873351, 8880865, 8889506, 8956876, 8975699, 9055299, 9083553, 9100669, 9354454, 9378774, 9395247, 9399891, 9408760, 9426397, 9466995, 9473065, 9488313, 9538131, 9635681, 9679758, 9702788, 9748471, 9779996, 9852312, 9863591		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	11063814		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	8741802		★☆☆☆☆ Found in Text Mining only
Nerve Sheath Tumors	Nerve Sheath Tumors	BEFREE	10403310		★☆☆☆☆ Found in Text Mining only
Nerve Sheath Tumors	Nerve Sheath Tumors	LHGDN	13679444		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	17655741, 31298338	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	12471027, 16857415, 17566081, 18445079, 19968670, 21647202, 22821509, 30816526, 7981675		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	10214350, 10394935, 10462524, 10606247, 10771486, 10887156, 11085592, 11106352, 11129530, 11132929, 11148074, 11285248, 11380622, 11448944, 11666013, 11773000, 12407444, 12444101, 12444102, 12544854, 12579316, 12665675, 12752143, 12946024, 1384671, 14566860, 14612918, 14627667, 14654541, 14724586, 15598747, 15639530, 15837555, 15937644, 16078050, 16232328, 16409122, 17083475, 17210637, 17216226, 17509660, 17566081, 17655741, 17868749, 18240308, 18445079, 19029950, 19148485, 19451225, 20491622, 20600642, 20729918, 20872275, 21278391, 21383154, 21647202, 21903608, 22281088, 22426462, 22431917, 22821509, 22911524, 23318455, 23354516, 23413263, 23666797, 24259290, 24450866, 24964769, 25217104, 25533176, 25739810, 25893302, 28126595, 28478817, 28692055, 28729415, 28775147, 28824165, 28885122, 29322178, 29599333, 29761250, 30145722, 30274821, 30615146, 31789805, 7529050, 7669741, 7951231, 8004107, 8012353, 8162016, 8655145, 8700556, 8873351, 8880865, 8889506, 9083553, 9100669, 9354454, 9378774, 9403715, 9473065, 9679758, 9852312, 9862639		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	12444102, 12665675, 14566860, 14612918, 17509660, 18033041, 18445079		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12402304, 16721359, 21903608		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31831796		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	17695403, 18766994, 9354454		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	11756780, 23666797, 23939548, 30816526, 31585900, 9354454		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	Pubtator	24443315, 30908877	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	Pubtator	24676443, 32461616	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	Pubtator	30816526	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	10771486, 11756780, 12082543, 12709270, 19966658, 22210082, 23666797, 23939548, 25490687, 26851632, 30816526, 31585900, 8630973, 9354454		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	31730023	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	UNIPROT_DG	10090912, 10669747, 10790209, 12709270, 20178741, 20445339, 7666400, 7759081, 7913580, 8081368, 8230593, 8566958, 8698340, 9643284		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	BEFREE	10214350, 10338003, 10369886, 10389885, 10561699, 10606247, 10712203, 10720287, 10771486, 10777666, 11020177, 11070492, 11085592, 11159946, 11257108, 11290539, 11547953, 11773000, 11809806, 12082543, 12116319, 12210058, 12356905, 12407444, 12444102, 12471027, 12544854, 12579316, 12673723, 12752143, 12830322, 12946024, 1336685, 14566860, 14580336, 14627667, 14679203, 14724586, 1496981, 15000491, 15378014, 15467753, 15598747, 15609345, 15639530, 15684865, 15937644, 15994874, 16324214, 16398470, 16409122, 16436990, 16497727, 16652148, 16879395, 17210637, 17234759, 17509660, 17607601, 17655741, 17721284, 17868749, 17940085, 18332868, 18361411, 18445079, 18486129, 18554169, 18593924, 18670066, 18725387, 18829550, 18839347, 18953429, 19793348, 19968670, 2039155, 20491622, 20729918, 20831745, 20872275, 21175598, 21383154, 21906157, 22038540, 22081132, 22210082, 22286761, 22329991, 22426462, 22431917, 22436304, 22618028, 22798428, 22821509, 22912849, 22931905, 23036697, 23151902, 23267122, 23377185, 23455610, 23677068, 23931824, 23934191, 24259290, 24323642, 24357459, 24393766, 24612193, 24667735, 24786638, 24848258, 25012216, 25113746, 25217104, 25490687, 25596744, 25750037, 25857641, 25893302, 25931164, 26840621, 26851632, 27345717, 27601049, 27655473, 27921248, 27958595, 28126595, 28427224, 28468780, 28729415, 28885122, 29130106, 29249622, 29408605, 29587439, 29599333, 29626191, 29715273, 29897904, 30143526, 30615146, 30624408, 31063758, 31171721, 31231129, 31296571, 31312020, 31424590, 31567203, 31652973, 31715329, 31730023, 7485407, 7497438, 7503383, 7504514, 7607639, 7617190, 7669741, 7670657, 7685627, 7868131, 7911002, 7913580, 7951231, 8004107, 8012353, 8230593, 8261460, 8401504, 8413972, 8453669, 8566958, 8655145, 8751853, 8757035, 8805149, 8873351, 8909442, 9083553, 9143261, 9378774, 9395247, 9426397, 9466988, 9473065, 9488313, 9605590, 9635681, 9643284, 9674507, 9679758, 9748471, 9817927, 9852312, 9862639		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	CLINGEN_DG	10887156, 12118253, 16652148, 19451225, 24726726, 25113746, 7795605, 7913580, 8751853, 9171370, 9553042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	CLINVAR_DG	11085592, 12566519, 16983642, 18033041, 18173316, 18670066, 18766994, 22295085, 24815379, 26066488, 26073919, 27704245, 7711726, 7759081, 7913580, 8012353, 8379998, 8755919, 8797533, 8882871, 9643284, 9884492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	LHGDN	11836375, 11839955, 15980114, 18670066, 18766994		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	CTD_human_DG	12136076		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	Pubtator	12946024, 1479598, 1479599, 15779232, 16421138, 17868749, 18953429, 23188051, 24357459, 24667735, 26045165, 26549023, 27345717, 31296571, 34352618, 34918118, 36077416, 36809290, 37272647, 38115252, 7485407, 7666400, 9466995, 9643284, 9718334	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	Pubtator	14627667, 20511180, 21383154, 24558021, 25567352, 28427224	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	GENOMICS_ENGLAND_DG	19880713, 23788249, 29409008, 7913580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 2	Neurofibromatosis	Pubtator	2105641, 37904024	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis 3	Neurofibromatosis	ORPHANET_DG	23401320		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis type 2	Neurofibromatosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurofibromatosis, Type 3, mixed central and peripheral	Neurofibromatosis	ORPHANET_DG	23401320		★☆☆☆☆ Found in Text Mining only
Neuroma, Acoustic, Bilateral	Bilateral vestibular Schwannoma	CTD_human_DG	12136076		★☆☆☆☆ Found in Text Mining only
Neuroma, Acoustic, Bilateral	Bilateral vestibular Schwannoma	BEFREE	16721359		★☆☆☆☆ Found in Text Mining only
Neuroma, Acoustic, Bilateral	Bilateral vestibular Schwannoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	20113402		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	15351774, 18519823		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23435014		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17505464		★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	18976311	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17137505, 23282078		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★☆☆☆☆ Found in Text Mining only
Occasional neurofibromas	Neurofibroma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oculomotor Nerve Paralysis	Oculomotor nerve palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30759864		★☆☆☆☆ Found in Text Mining only
Olfactory Groove Meningioma	Olfactory Groove Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	11996787		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15580288		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16824698		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11205287, 23541585, 26908451, 29157102		★☆☆☆☆ Found in Text Mining only
Papillary Meningioma	Papillary Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parasagittal Meningioma	Parasagittal Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	29459835		★☆☆☆☆ Found in Text Mining only
Perineurioma	Perineurioma	BEFREE	10403310, 17163160		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral Schwannoma	Peripheral Schwannoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	31570769	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	25798586, 26493618, 28910456, 31570769, 37453150	Associate	★☆☆☆☆ Found in Text Mining only
Perivascular Epithelioid Cell Neoplasms	Perivascular Epithelioid Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	25889843, 26853494	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Neoplasms	Pleural Neoplasms	CTD_human_DG	23435014		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	35122417	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	17655741	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	17655741, 23455610		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	LHGDN	17655741		★☆☆☆☆ Found in Text Mining only
Posterior fossa compression syndrome	Brain stem compression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Posterior Fossa Meningioma	Fossa Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18361411, 25893302, 28901516		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18361411		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31756185	Associate	★☆☆☆☆ Found in Text Mining only
Psammomatous Meningioma	Psammomatous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Psammomatous Meningioma	Psammomatous Meningioma	BEFREE	9055299		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17505464		★☆☆☆☆ Found in Text Mining only
PTEN Hamartoma Tumor Syndrome	PTEN Hamartoma Tumor Syndrome	BEFREE	22281088		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31063758		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22081132		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21728808		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	8751853	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	8741802		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	18087273	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	32542935	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma, Spindle Cell	Sarcoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17012685, 17440434		★☆☆☆☆ Found in Text Mining only
Schwannoma, Acoustic, Bilateral	Schwannoma	CTD_human_DG	12136076		★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	BEFREE	10369886, 12975302, 17940085, 18072270, 18285426, 26706012, 27958595, 9399891		★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	Pubtator	16421138, 22083253, 22558206, 24362817, 24443315, 24815379, 25335493, 27856782, 32281771, 33025139, 33903738, 35361920, 35674741, 35723634, 37280085, 40355925, 40725095, 7798645, 9120449, 9399891	Associate	★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	ORPHANET_DG	23401320		★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
SCHWANNOMATOSIS 1	Schwannomatosis	GENOMICS_ENGLAND_DG	19880713, 23788249		★☆☆☆☆ Found in Text Mining only
SCHWANNOMATOSIS 1	Schwannomatosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Secondary growth hormone deficiency	Growth Hormone Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	16082381		★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	BEFREE	17721284		★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	29322178	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	10771486, 16857415		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	10771486, 35729665	Associate	★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sphenoid Wing Meningioma	Sphenoid Wing Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Spinal Cord Neoplasms	Spinal Cord Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spinal Meningioma	Spinal Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Spinal Meningioma	Spinal Meningioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35756403	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	Pubtator	18976311	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	26443326	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26320103, 31257748	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	25576899, 31257748	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31257748, 38275291	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Transitional Meningioma	Transitional Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	HPO_DG			★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	BEFREE	12356905		★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	31151928		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	8741802		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	11996787		★☆☆☆☆ Found in Text Mining only
Xanthomatosis Cerebrotendinous	Xanthomatosis	Pubtator	27378628	Inhibit	★☆☆☆☆ Found in Text Mining only
Xanthomatous Meningioma	Xanthomatous Meningioma	CTD_human_DG	23334667		★☆☆☆☆ Found in Text Mining only