Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	474354
Gene name	Leucine rich repeat containing 18
Gene symbol	LRRC18
Synonyms (NCBI Gene)	UNQ933UNQ9338VKGE9338
Chromosome	10
Chromosome location	10q11.23

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT1118996	hsa-miR-1321	CLIP-seq
MIRT1118997	hsa-miR-3150b-3p	CLIP-seq
MIRT1118998	hsa-miR-3165	CLIP-seq
MIRT1118999	hsa-miR-3179	CLIP-seq
MIRT1119000	hsa-miR-3190	CLIP-seq
MIRT1119001	hsa-miR-3202	CLIP-seq
MIRT1119002	hsa-miR-3689d	CLIP-seq
MIRT1119003	hsa-miR-4419a	CLIP-seq
MIRT1119004	hsa-miR-4436b-5p	CLIP-seq
MIRT1119005	hsa-miR-4480	CLIP-seq
MIRT1119006	hsa-miR-4510	CLIP-seq
MIRT1119007	hsa-miR-4533	CLIP-seq
MIRT1119008	hsa-miR-4739	CLIP-seq
MIRT1119009	hsa-miR-4756-5p	CLIP-seq
MIRT1119010	hsa-miR-4784	CLIP-seq
MIRT1119011	hsa-miR-939	CLIP-seq
MIRT1920599	hsa-miR-193a-3p	CLIP-seq
MIRT1920600	hsa-miR-193b	CLIP-seq
MIRT1920601	hsa-miR-513a-3p	CLIP-seq
MIRT1920602	hsa-miR-892b	CLIP-seq
MIRT1920599	hsa-miR-193a-3p	CLIP-seq
MIRT1920600	hsa-miR-193b	CLIP-seq
MIRT1920601	hsa-miR-513a-3p	CLIP-seq
MIRT1920602	hsa-miR-892b	CLIP-seq
MIRT1920599	hsa-miR-193a-3p	CLIP-seq
MIRT1920600	hsa-miR-193b	CLIP-seq
MIRT1920601	hsa-miR-513a-3p	CLIP-seq
MIRT1920602	hsa-miR-892b	CLIP-seq
MIRT2033669	hsa-miR-759	CLIP-seq
MIRT1118998	hsa-miR-3165	CLIP-seq
MIRT1118999	hsa-miR-3179	CLIP-seq
MIRT1119000	hsa-miR-3190	CLIP-seq
MIRT1119001	hsa-miR-3202	CLIP-seq
MIRT1119004	hsa-miR-4436b-5p	CLIP-seq
MIRT1119007	hsa-miR-4533	CLIP-seq
MIRT2453322	hsa-miR-3074-3p	CLIP-seq
MIRT1118998	hsa-miR-3165	CLIP-seq
MIRT1118999	hsa-miR-3179	CLIP-seq
MIRT1119000	hsa-miR-3190	CLIP-seq
MIRT1119001	hsa-miR-3202	CLIP-seq
MIRT2453323	hsa-miR-365	CLIP-seq
MIRT1119004	hsa-miR-4436b-5p	CLIP-seq
MIRT1119007	hsa-miR-4533	CLIP-seq
MIRT2684180	hsa-miR-216a	CLIP-seq
MIRT2684181	hsa-miR-4450	CLIP-seq
MIRT2684182	hsa-miR-4667-5p	CLIP-seq
MIRT2684183	hsa-miR-4700-5p	CLIP-seq
MIRT2684184	hsa-miR-4762-5p	CLIP-seq

Show/Hide all (3)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0035556	Process	Intracellular signal transduction	IBA

MIM	HGNC	e!Ensembl
619002	23199	ENSG00000165383

Q8N456

Protein name

Leucine-rich repeat-containing protein 18

Protein function

May be involved in the regulation of spermatogenesis and sperm maturation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	30 → 85	Leucine rich repeat	Repeat
PF13855	LRR_8	50 → 108	Leucine rich repeat	Repeat
PF13855	LRR_8	73 → 133	Leucine rich repeat	Repeat

Sequence

MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRN
LIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQL
KNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFP
KPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNL
ISPNSMAKDSWEDWRIRLTSS

Sequence length

261

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
RECTUM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Coronary Artery Disease	Coronary artery disease	Pubtator	33686958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	19838193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	19838193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22972472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	35885976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★★★★★ ★☆☆☆☆ Found in Text Mining only

LRRC18 (leucine rich repeat containing 18)