Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	474344
Gene name	GTPase, IMAP family member 6
Gene symbol	GIMAP6
Synonyms (NCBI Gene)	IAN-2IAN-6IAN2IAN6
Chromosome	7
Chromosome location	7q36.1
Summary	This gene encodes a member of the GTPases of immunity-associated proteins (GIMAP) family. GIMAP proteins contain GTP-binding and coiled-coil motifs, and may play roles in the regulation of cell survival. Decreased expression of this gene may play a role i

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529951	hsa-miR-5003-5p	PAR-CLIP	22012620
MIRT529950	hsa-miR-4691-3p	PAR-CLIP	22012620
MIRT529949	hsa-miR-4269	PAR-CLIP	22012620
MIRT529948	hsa-miR-6715b-5p	PAR-CLIP	22012620
MIRT529947	hsa-miR-6849-3p	PAR-CLIP	22012620
MIRT529946	hsa-miR-6512-3p	PAR-CLIP	22012620
MIRT529945	hsa-miR-6720-5p	PAR-CLIP	22012620
MIRT529951	hsa-miR-5003-5p	PAR-CLIP	22012620
MIRT529950	hsa-miR-4691-3p	PAR-CLIP	22012620
MIRT529949	hsa-miR-4269	PAR-CLIP	22012620
MIRT529948	hsa-miR-6715b-5p	PAR-CLIP	22012620
MIRT529947	hsa-miR-6849-3p	PAR-CLIP	22012620
MIRT529946	hsa-miR-6512-3p	PAR-CLIP	22012620
MIRT529945	hsa-miR-6720-5p	PAR-CLIP	22012620
MIRT1018992	hsa-miR-10a	CLIP-seq
MIRT1018993	hsa-miR-10b	CLIP-seq
MIRT1018994	hsa-miR-1287	CLIP-seq
MIRT1018995	hsa-miR-135a	CLIP-seq
MIRT1018996	hsa-miR-135b	CLIP-seq
MIRT1018997	hsa-miR-3135b	CLIP-seq
MIRT1018998	hsa-miR-339-5p	CLIP-seq
MIRT1018999	hsa-miR-3661	CLIP-seq
MIRT1019000	hsa-miR-3909	CLIP-seq
MIRT1019001	hsa-miR-4254	CLIP-seq
MIRT1019002	hsa-miR-4282	CLIP-seq
MIRT1019003	hsa-miR-4463	CLIP-seq
MIRT1019004	hsa-miR-451b	CLIP-seq
MIRT1019005	hsa-miR-4646-5p	CLIP-seq
MIRT1019006	hsa-miR-4698	CLIP-seq
MIRT1019007	hsa-miR-4717-5p	CLIP-seq
MIRT1019008	hsa-miR-4725-5p	CLIP-seq
MIRT1019009	hsa-miR-4747-5p	CLIP-seq
MIRT1019010	hsa-miR-504	CLIP-seq
MIRT1019011	hsa-miR-520d-5p	CLIP-seq
MIRT1019012	hsa-miR-524-5p	CLIP-seq
MIRT1019013	hsa-miR-619	CLIP-seq
MIRT1019014	hsa-miR-631	CLIP-seq
MIRT1019015	hsa-miR-711	CLIP-seq
MIRT2001704	hsa-miR-219-5p	CLIP-seq
MIRT2001705	hsa-miR-3591-3p	CLIP-seq
MIRT2001706	hsa-miR-3688-5p	CLIP-seq
MIRT2001707	hsa-miR-4291	CLIP-seq
MIRT2001708	hsa-miR-4445	CLIP-seq
MIRT2001709	hsa-miR-4474-3p	CLIP-seq
MIRT2001710	hsa-miR-4514	CLIP-seq
MIRT2001711	hsa-miR-4692	CLIP-seq
MIRT2001712	hsa-miR-4716-5p	CLIP-seq
MIRT2001713	hsa-miR-4722-3p	CLIP-seq
MIRT2001714	hsa-miR-4782-3p	CLIP-seq
MIRT2001715	hsa-miR-508-3p	CLIP-seq
MIRT2001716	hsa-miR-545	CLIP-seq
MIRT2234761	hsa-miR-1293	CLIP-seq
MIRT2234762	hsa-miR-1297	CLIP-seq
MIRT2001704	hsa-miR-219-5p	CLIP-seq
MIRT2234763	hsa-miR-26a	CLIP-seq
MIRT2234764	hsa-miR-26b	CLIP-seq
MIRT2234765	hsa-miR-342-5p	CLIP-seq
MIRT2234766	hsa-miR-3650	CLIP-seq
MIRT2001706	hsa-miR-3688-5p	CLIP-seq
MIRT2001708	hsa-miR-4445	CLIP-seq
MIRT2234767	hsa-miR-4465	CLIP-seq
MIRT2001709	hsa-miR-4474-3p	CLIP-seq
MIRT2234768	hsa-miR-4483	CLIP-seq
MIRT2234769	hsa-miR-4651	CLIP-seq
MIRT2234770	hsa-miR-4653-3p	CLIP-seq
MIRT2234771	hsa-miR-4664-5p	CLIP-seq
MIRT2001714	hsa-miR-4782-3p	CLIP-seq
MIRT2234772	hsa-miR-498	CLIP-seq
MIRT2001715	hsa-miR-508-3p	CLIP-seq
MIRT2234773	hsa-miR-516b	CLIP-seq
MIRT2234774	hsa-miR-541	CLIP-seq
MIRT2234775	hsa-miR-574-5p	CLIP-seq
MIRT2234776	hsa-miR-608	CLIP-seq
MIRT2234777	hsa-miR-654-5p	CLIP-seq
MIRT2388449	hsa-miR-122	CLIP-seq
MIRT2388450	hsa-miR-3173-3p	CLIP-seq
MIRT2388451	hsa-miR-4256	CLIP-seq
MIRT2388452	hsa-miR-4428	CLIP-seq
MIRT2388453	hsa-miR-4477b	CLIP-seq
MIRT2388454	hsa-miR-4762-5p	CLIP-seq
MIRT2234775	hsa-miR-574-5p	CLIP-seq
MIRT2450271	hsa-miR-4659a-5p	CLIP-seq
MIRT2450272	hsa-miR-4659b-5p	CLIP-seq
MIRT2001712	hsa-miR-4716-5p	CLIP-seq
MIRT2450273	hsa-miR-4769-3p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23454188
GO:0005829	Component	Cytosol	IEA

MIM	HGNC	e!Ensembl
616960	21918	ENSG00000133561

Q6P9H5

Protein name

GTPase IMAP family member 6 (Immunity-associated nucleotide 2 protein) (IAN-2) (hIAN2) (Immunity-associated nucleotide 6 protein) (IAN-6) (hIAN6)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04548	AIG1	41 → 252	AIG1 family	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, lymph nodes, lung and placenta. Expressed at moderate level in thymus, kidney, heart and digestive tract. Weakly expressed in other lymphoid tissues. Detected in T-cells. {ECO:0000269|PubMed:15474311, ECO:00

Sequence

MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSI
LGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSA
PGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRET
NNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQ
QNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL

Sequence length

292

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Primary Immune Deficiency	Likely pathogenic	rs767832540	RCV001254928	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	32523132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27667392	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	32523132	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28630090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31952466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	33328581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27667392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18462827, 27667392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	GWASCAT_DG	30837455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Young Syndrome	Young syndrome	Pubtator	33328581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GIMAP6 (GTPase, IMAP family member 6)