Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4739
Gene name	Neural precursor cell expressed, developmentally down-regulated 9
Gene symbol	NEDD9
Synonyms (NCBI Gene)	CAS-LCAS2CASLCASS2HEF1
Chromosome	6
Chromosome location	6p24.2
Summary	The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protei

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006817	hsa-miR-18a-5p	qRT-PCRWestern blot	22308110
MIRT006889	hsa-miR-145-5p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	22869051
MIRT006889	hsa-miR-145-5p	Luciferase reporter assay	23355420
MIRT047916	hsa-miR-30c-5p	CLASH	23622248
MIRT006889	hsa-miR-145-5p	Luciferase reporter assayqRT-PCR	24384875
MIRT006889	hsa-miR-145-5p	Luciferase reporter assayqRT-PCR	24384875
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT454817	hsa-miR-3609	PAR-CLIP	23592263
MIRT454815	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT454814	hsa-miR-4506	PAR-CLIP	23592263
MIRT454813	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT454812	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT454811	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT454810	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT454809	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454808	hsa-miR-520h	PAR-CLIP	23592263
MIRT454807	hsa-miR-5702	PAR-CLIP	23592263
MIRT454806	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT454805	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT454804	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT454803	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT454802	hsa-miR-5682	PAR-CLIP	23592263
MIRT454801	hsa-miR-4477a	PAR-CLIP	23592263
MIRT454800	hsa-miR-642a-5p	PAR-CLIP	23592263
MIRT454799	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT454798	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT440124	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440124	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT454817	hsa-miR-3609	PAR-CLIP	23592263
MIRT454815	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT454814	hsa-miR-4506	PAR-CLIP	23592263
MIRT454813	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT454812	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT454811	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT454810	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT454809	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454808	hsa-miR-520h	PAR-CLIP	23592263
MIRT454807	hsa-miR-5702	PAR-CLIP	23592263
MIRT454806	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT454805	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT454804	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT454803	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT454802	hsa-miR-5682	PAR-CLIP	23592263
MIRT454801	hsa-miR-4477a	PAR-CLIP	23592263
MIRT454800	hsa-miR-642a-5p	PAR-CLIP	23592263
MIRT454799	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT454798	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT1179924	hsa-miR-105	CLIP-seq
MIRT1179925	hsa-miR-1321	CLIP-seq
MIRT1179926	hsa-miR-1915	CLIP-seq
MIRT1179927	hsa-miR-298	CLIP-seq
MIRT1179928	hsa-miR-302f	CLIP-seq
MIRT1179929	hsa-miR-3136-5p	CLIP-seq
MIRT1179930	hsa-miR-3163	CLIP-seq
MIRT1179931	hsa-miR-3612	CLIP-seq
MIRT1179932	hsa-miR-3662	CLIP-seq
MIRT1179933	hsa-miR-4270	CLIP-seq
MIRT1179934	hsa-miR-4323	CLIP-seq
MIRT1179935	hsa-miR-4439	CLIP-seq
MIRT1179936	hsa-miR-4441	CLIP-seq
MIRT1179937	hsa-miR-4513	CLIP-seq
MIRT1179938	hsa-miR-4699-5p	CLIP-seq
MIRT1179939	hsa-miR-4719	CLIP-seq
MIRT1179940	hsa-miR-4739	CLIP-seq
MIRT1179941	hsa-miR-4756-5p	CLIP-seq
MIRT1179942	hsa-miR-4762-3p	CLIP-seq
MIRT1179943	hsa-miR-4766-5p	CLIP-seq
MIRT1179944	hsa-miR-650	CLIP-seq
MIRT1179945	hsa-miR-943	CLIP-seq
MIRT1179946	hsa-miR-34b	CLIP-seq
MIRT1179947	hsa-miR-3921	CLIP-seq
MIRT1179948	hsa-miR-4251	CLIP-seq
MIRT1179949	hsa-miR-4329	CLIP-seq
MIRT1179950	hsa-miR-4639-3p	CLIP-seq
MIRT1179951	hsa-miR-4653-5p	CLIP-seq
MIRT1179952	hsa-miR-4714-5p	CLIP-seq
MIRT2052033	hsa-miR-18a	CLIP-seq
MIRT2052034	hsa-miR-18b	CLIP-seq
MIRT2052035	hsa-miR-203	CLIP-seq
MIRT2052036	hsa-miR-4729	CLIP-seq
MIRT2052037	hsa-miR-4735-3p	CLIP-seq
MIRT1179932	hsa-miR-3662	CLIP-seq
MIRT2281397	hsa-miR-1266	CLIP-seq
MIRT2281398	hsa-miR-1294	CLIP-seq
MIRT2281399	hsa-miR-144	CLIP-seq
MIRT2052033	hsa-miR-18a	CLIP-seq
MIRT2052034	hsa-miR-18b	CLIP-seq
MIRT2281400	hsa-miR-3150b-3p	CLIP-seq
MIRT2281401	hsa-miR-3688-3p	CLIP-seq
MIRT2281402	hsa-miR-4316	CLIP-seq
MIRT2281403	hsa-miR-4328	CLIP-seq
MIRT2281404	hsa-miR-4518	CLIP-seq
MIRT2281405	hsa-miR-4652-3p	CLIP-seq
MIRT2281406	hsa-miR-4689	CLIP-seq
MIRT2052037	hsa-miR-4735-3p	CLIP-seq
MIRT2281407	hsa-miR-4760-3p	CLIP-seq
MIRT2281408	hsa-miR-4784	CLIP-seq
MIRT2281409	hsa-miR-510	CLIP-seq
MIRT2281410	hsa-miR-520d-5p	CLIP-seq
MIRT2281411	hsa-miR-524-5p	CLIP-seq
MIRT2281412	hsa-miR-576-3p	CLIP-seq
MIRT2281412	hsa-miR-576-3p	CLIP-seq
MIRT2431535	hsa-miR-3157-5p	CLIP-seq
MIRT2431536	hsa-miR-4691-3p	CLIP-seq
MIRT2431537	hsa-miR-4705	CLIP-seq
MIRT2579581	hsa-miR-1207-3p	CLIP-seq
MIRT2579582	hsa-miR-4307	CLIP-seq
MIRT2579583	hsa-miR-4774-5p	CLIP-seq
MIRT2579584	hsa-miR-567	CLIP-seq
MIRT2579581	hsa-miR-1207-3p	CLIP-seq
MIRT2579582	hsa-miR-4307	CLIP-seq
MIRT2579583	hsa-miR-4774-5p	CLIP-seq
MIRT2579584	hsa-miR-567	CLIP-seq

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0000922	Component	Spindle pole	ISS
GO:0001772	Component	Immunological synapse	IEA
GO:0001772	Component	Immunological synapse	ISS
GO:0005515	Function	Protein binding	IPI	9360983, 11827972, 15051726, 16394104, 19103205, 19275884, 21516116, 22810897, 24574519, 25416956, 28514442, 29191835, 29899023, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	29899023
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8668148
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9584194
GO:0005794	Component	Golgi apparatus	IEA
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	TAS	9584194
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	19103205, 19275884
GO:0005925	Component	Focal adhesion	IEA
GO:0005929	Component	Cilium	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007010	Process	Cytoskeleton organization	NAS	11827972
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	9584194
GO:0007165	Process	Signal transduction	TAS	8668148
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	11827972
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016477	Process	Cell migration	IBA
GO:0030027	Component	Lamellipodium	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18256281
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0036064	Component	Ciliary basal body	IDA	17604723
GO:0042995	Component	Cell projection	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	ISS
GO:0051017	Process	Actin filament bundle assembly	NAS	11827972
GO:0051301	Process	Cell division	IEA
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IDA	18256281
GO:0061523	Process	Cilium disassembly	IMP	17604723
GO:0070161	Component	Anchoring junction	IEA
GO:0072686	Component	Mitotic spindle	IDA	16394104
GO:0097021	Process	Lymphocyte migration into lymphoid organs	IEA
GO:0097021	Process	Lymphocyte migration into lymphoid organs	ISS
GO:0140131	Process	Positive regulation of lymphocyte chemotaxis	IEA
GO:0140131	Process	Positive regulation of lymphocyte chemotaxis	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	18256281
GO:1902952	Process	Positive regulation of dendritic spine maintenance	IEA
GO:1902952	Process	Positive regulation of dendritic spine maintenance	ISS
GO:1903829	Process	Positive regulation of protein localization	IEA
GO:1903829	Process	Positive regulation of protein localization	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	18256281
GO:2000522	Process	Positive regulation of immunological synapse formation	IEA
GO:2000522	Process	Positive regulation of immunological synapse formation	ISS

MIM	HGNC	e!Ensembl
602265	7733	ENSG00000111859

Q14511

Protein name

Enhancer of filamentation 1 (hEF1) (CRK-associated substrate-related protein) (CAS-L) (CasL) (Cas scaffolding protein family member 2) (CASS2) (Neural precursor cell expressed developmentally down-regulated protein 9) (NEDD-9) (Renal carcinoma antigen NY-

Protein function

Scaffolding protein which plays a central coordinating role for tyrosine-kinase-based signaling related to cell adhesion (PubMed:24574519). As a focal adhesion protein, plays a role in embryonic fibroblast migration (By similarity). May play an

PDB

2L81 , 5X3S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	10 → 61	Variant SH3 domain	Domain
PF08824	Serine_rich	404 → 560	Serine rich protein interaction domain	Domain
PF12026	CAS_C	619 → 828	Crk-Associated Substrate C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in B-cells (at protein level) (PubMed:9020138). Expressed in the respiratory epithelium of the main bronchi to the bronchioles in the lungs (at protein level) (PubMed:9584194). High levels detected in kidney, lung, and placen

Sequence

MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIP
PSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKD
YDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPN
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRD
LVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELI
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHN
KALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQDIRNKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF

Sequence length

834

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC INTESTINAL VASCULAR INSUFFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEDD9-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARALYTIC STRABISMUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (116)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1612589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22447485, 25051398, 28714018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	29364471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	21317929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18063669, 20430066, 21059344		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29924959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12847683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	37771106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Experimental	Experimental arthritis	Pubtator	37771106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29436741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17913447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23468652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18256281, 21829474, 24174333, 24202705, 24676793, 28123587, 28235899, 31801619, 31828433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21145356, 24676793, 25319010, 31462898, 32638964, 35844785, 36604412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21829474	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	40362444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11948459, 2015552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23086683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29364471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17676035, 22732573, 23037767, 23074285, 23086683, 24174333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23247867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29924959	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24384875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26351211	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37185598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40362444	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	29364471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24439227, 29773902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25967390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11765912, 31524268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20068165, 20442290, 21317929, 28000901, 31516604, 31671847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20442290, 24966970, 25824783, 36604412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	26279205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24384875, 26351211, 29344245, 8756377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	17124531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31357086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	29931343	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24439227		★★★★★ ★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	19412734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19417561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	22605921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	GWASDB_DG	22605921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22869051, 24337070, 26663363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22869051, 24337070, 26663363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22869051, 2377285, 24337070		★★★★★ ★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	2569301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	2569301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29899023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20442290, 31462898	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29899023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36604412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8485048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22911555, 25812772, 27974675, 28578938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23074285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40362444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15162435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15162435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15162435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15162435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23086683, 23247867, 24058594, 24664584, 24676793	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1677032, 2569301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	8289506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18256281, 21829474, 24174333, 24202705, 24676793, 28235899, 31801619, 31828433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29084958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17676035, 22732573, 23037767, 23074285, 23086683, 24174333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29773902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29924959, 30544746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27078000, 29436741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11948459, 1913456, 24664584, 25577245, 31019460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16931583, 1913456, 22869051, 24174333, 24202705, 24439227, 25812772, 25967390, 28235899, 31213839, 8756377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21829474		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16814714, 16843259, 17908996, 21285511, 21317929, 22328516, 24174333, 26968260, 29876004, 30642390		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17908996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18977323, 18984162, 26968260, 28273108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	7773151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21283797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21283797	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12414652, 17703068, 20068165, 21317929, 22328516, 22447485, 22869051, 23086683, 2377285, 24337070, 24469954, 24664584, 24676793, 25051398, 25812772 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24337070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12174885, 22732573, 23037767, 23086683, 31332786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29773902		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24439227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29924959, 30544746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23247867, 29924959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23247867	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25646678, 29924959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18063669, 18579580, 20430066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18579580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23247867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	40016711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	25967390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1612589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	25217961, 29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	27078000, 29436741		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24413182, 27078000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29899023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	31952977	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24384875, 26351211, 29344245, 8756377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12414652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12847683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	30854064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32176034	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	29876004, 7913703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20498643, 32595251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29876004, 30267961, 7913703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11948459, 2015552, 24469954, 24664584, 25577245, 31019460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24664584, 25577245, 33485292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	28194179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	29649988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28194179, 30662804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21829474, 28235899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21829474	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17124531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30003752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24058594, 39206965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NEDD9 (neural precursor cell expressed, developmentally down-regulated 9)