Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4725
Gene name	NADH:ubiquinone oxidoreductase subunit S5
Gene symbol	NDUFS5
Synonyms (NCBI Gene)	CI-15kCI15K
Chromosome	1
Chromosome location	1p34.3
Summary	This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mito

166

Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051532	hsa-let-7e-5p	CLASH	23622248
MIRT036146	hsa-miR-1296-5p	CLASH	23622248
MIRT692773	hsa-miR-1255b-2-3p	HITS-CLIP	23313552
MIRT692772	hsa-miR-890	HITS-CLIP	23313552
MIRT692771	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT692770	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT692769	hsa-miR-940	HITS-CLIP	23313552
MIRT692768	hsa-miR-3929	HITS-CLIP	23313552
MIRT692767	hsa-miR-4419b	HITS-CLIP	23313552
MIRT692766	hsa-miR-4478	HITS-CLIP	23313552
MIRT692765	hsa-miR-5588-3p	HITS-CLIP	23313552
MIRT692764	hsa-miR-2114-5p	HITS-CLIP	23313552
MIRT692763	hsa-miR-5690	HITS-CLIP	23313552
MIRT692762	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT692761	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT692760	hsa-miR-589-5p	HITS-CLIP	23313552
MIRT692759	hsa-miR-1827	HITS-CLIP	23313552
MIRT692758	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT692757	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT692756	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT692755	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT692754	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT692753	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT692752	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT692751	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT692750	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT692749	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT692748	hsa-miR-7977	HITS-CLIP	23313552
MIRT692747	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT692746	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT692745	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT692744	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT692743	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT692742	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT692741	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT692740	hsa-miR-3689c	HITS-CLIP	23313552
MIRT692739	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT692738	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT692737	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT692736	hsa-miR-665	HITS-CLIP	23313552
MIRT692773	hsa-miR-1255b-2-3p	HITS-CLIP	23313552
MIRT692772	hsa-miR-890	HITS-CLIP	23313552
MIRT692771	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT692770	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT692769	hsa-miR-940	HITS-CLIP	23313552
MIRT692768	hsa-miR-3929	HITS-CLIP	23313552
MIRT692767	hsa-miR-4419b	HITS-CLIP	23313552
MIRT692766	hsa-miR-4478	HITS-CLIP	23313552
MIRT692765	hsa-miR-5588-3p	HITS-CLIP	23313552
MIRT692764	hsa-miR-2114-5p	HITS-CLIP	23313552
MIRT692763	hsa-miR-5690	HITS-CLIP	23313552
MIRT692762	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT692761	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT692760	hsa-miR-589-5p	HITS-CLIP	23313552
MIRT692759	hsa-miR-1827	HITS-CLIP	23313552
MIRT692758	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT692757	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT692756	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT692755	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT692754	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT692753	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT692752	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT692751	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT692750	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT692749	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT692748	hsa-miR-7977	HITS-CLIP	23313552
MIRT692747	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT692746	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT692745	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT692744	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT692743	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT692742	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT692741	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT692740	hsa-miR-3689c	HITS-CLIP	23313552
MIRT692739	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT692738	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT692737	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT692736	hsa-miR-665	HITS-CLIP	23313552
MIRT1179223	hsa-miR-1265	CLIP-seq
MIRT1179224	hsa-miR-2392	CLIP-seq
MIRT1179225	hsa-miR-3173-3p	CLIP-seq
MIRT1179226	hsa-miR-329	CLIP-seq
MIRT1179227	hsa-miR-362-3p	CLIP-seq
MIRT1179228	hsa-miR-3941	CLIP-seq
MIRT1179229	hsa-miR-4464	CLIP-seq
MIRT1179230	hsa-miR-4534	CLIP-seq
MIRT1179231	hsa-miR-466	CLIP-seq
MIRT1179232	hsa-miR-4672	CLIP-seq
MIRT1179233	hsa-miR-4748	CLIP-seq
MIRT1179234	hsa-miR-500a	CLIP-seq
MIRT1179235	hsa-miR-501-5p	CLIP-seq
MIRT1179236	hsa-miR-514	CLIP-seq
MIRT1179237	hsa-miR-514b-3p	CLIP-seq
MIRT1179238	hsa-miR-603	CLIP-seq
MIRT2051771	hsa-miR-214	CLIP-seq
MIRT2051772	hsa-miR-3194-3p	CLIP-seq
MIRT2051773	hsa-miR-3619-5p	CLIP-seq
MIRT2051774	hsa-miR-3913-3p	CLIP-seq
MIRT2051775	hsa-miR-3925-5p	CLIP-seq
MIRT2051776	hsa-miR-4291	CLIP-seq
MIRT2051777	hsa-miR-4773	CLIP-seq
MIRT2051778	hsa-miR-646	CLIP-seq
MIRT2051779	hsa-miR-761	CLIP-seq
MIRT2051780	hsa-miR-922	CLIP-seq
MIRT2051771	hsa-miR-214	CLIP-seq
MIRT2051772	hsa-miR-3194-3p	CLIP-seq
MIRT2051773	hsa-miR-3619-5p	CLIP-seq
MIRT2051774	hsa-miR-3913-3p	CLIP-seq
MIRT2051776	hsa-miR-4291	CLIP-seq
MIRT2051778	hsa-miR-646	CLIP-seq
MIRT2051779	hsa-miR-761	CLIP-seq
MIRT2051780	hsa-miR-922	CLIP-seq
MIRT2579355	hsa-miR-145	CLIP-seq
MIRT2579356	hsa-miR-1825	CLIP-seq
MIRT2579357	hsa-miR-199a-5p	CLIP-seq
MIRT2579358	hsa-miR-199b-5p	CLIP-seq
MIRT2051771	hsa-miR-214	CLIP-seq
MIRT2579359	hsa-miR-30a	CLIP-seq
MIRT2579360	hsa-miR-30b	CLIP-seq
MIRT2579361	hsa-miR-30c	CLIP-seq
MIRT2579362	hsa-miR-30d	CLIP-seq
MIRT2579363	hsa-miR-30e	CLIP-seq
MIRT1179225	hsa-miR-3173-3p	CLIP-seq
MIRT2579364	hsa-miR-3180-5p	CLIP-seq
MIRT2051772	hsa-miR-3194-3p	CLIP-seq
MIRT2051773	hsa-miR-3619-5p	CLIP-seq
MIRT2051774	hsa-miR-3913-3p	CLIP-seq
MIRT2579365	hsa-miR-3919	CLIP-seq
MIRT2051775	hsa-miR-3925-5p	CLIP-seq
MIRT2051776	hsa-miR-4291	CLIP-seq
MIRT2579366	hsa-miR-4434	CLIP-seq
MIRT1179229	hsa-miR-4464	CLIP-seq
MIRT2579367	hsa-miR-4516	CLIP-seq
MIRT2579368	hsa-miR-4531	CLIP-seq
MIRT1179233	hsa-miR-4748	CLIP-seq
MIRT2051777	hsa-miR-4773	CLIP-seq
MIRT2051778	hsa-miR-646	CLIP-seq
MIRT2051779	hsa-miR-761	CLIP-seq
MIRT2051780	hsa-miR-922	CLIP-seq
MIRT2579355	hsa-miR-145	CLIP-seq
MIRT2579356	hsa-miR-1825	CLIP-seq
MIRT2579357	hsa-miR-199a-5p	CLIP-seq
MIRT2579358	hsa-miR-199b-5p	CLIP-seq
MIRT2051771	hsa-miR-214	CLIP-seq
MIRT2579359	hsa-miR-30a	CLIP-seq
MIRT2579360	hsa-miR-30b	CLIP-seq
MIRT2579361	hsa-miR-30c	CLIP-seq
MIRT2579362	hsa-miR-30d	CLIP-seq
MIRT2579363	hsa-miR-30e	CLIP-seq
MIRT1179225	hsa-miR-3173-3p	CLIP-seq
MIRT2579364	hsa-miR-3180-5p	CLIP-seq
MIRT2051772	hsa-miR-3194-3p	CLIP-seq
MIRT2051773	hsa-miR-3619-5p	CLIP-seq
MIRT2051774	hsa-miR-3913-3p	CLIP-seq
MIRT2579365	hsa-miR-3919	CLIP-seq
MIRT2051775	hsa-miR-3925-5p	CLIP-seq
MIRT2051776	hsa-miR-4291	CLIP-seq
MIRT2579366	hsa-miR-4434	CLIP-seq
MIRT1179229	hsa-miR-4464	CLIP-seq
MIRT2579367	hsa-miR-4516	CLIP-seq
MIRT2579368	hsa-miR-4531	CLIP-seq
MIRT1179233	hsa-miR-4748	CLIP-seq
MIRT2051777	hsa-miR-4773	CLIP-seq
MIRT2051778	hsa-miR-646	CLIP-seq
MIRT2051779	hsa-miR-761	CLIP-seq
MIRT2051780	hsa-miR-922	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17500595, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	16826196
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551, 10070614
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551, 10070614
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IBA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	11112787
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551, 10070614
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603847	7712	ENSG00000168653

O43920

Protein name

NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (Complex I-15 kDa) (CI-15 kDa) (NADH-ubiquinone oxidoreductase 15 kDa subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10200	Ndufs5	1 → 96	NADH:ubiquinone oxidoreductase, NDUFS5-15kDa	Family

Sequence

MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY
DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Sequence length

106

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37334608	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37545529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	32138671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37334608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34863158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32138671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30782949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32138671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NDUFS5 (NADH:ubiquinone oxidoreductase subunit S5)