Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4710
Gene name	NADH:ubiquinone oxidoreductase subunit B4
Gene symbol	NDUFB4
Synonyms (NCBI Gene)	B15CI-B15
Chromosome	3
Chromosome location	3q13.33
Summary	This gene encodes a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase, the first enzyme complex in the mitochondrial electron transport chain (complex I). Mammalian complex I is composed of 45 different subunits and transfers electr

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028749	hsa-miR-26b-5p	Microarray	19088304
MIRT1178977	hsa-miR-1280	CLIP-seq
MIRT1178978	hsa-miR-1287	CLIP-seq
MIRT1178979	hsa-miR-1976	CLIP-seq
MIRT1178980	hsa-miR-3135b	CLIP-seq
MIRT1178981	hsa-miR-3145-5p	CLIP-seq
MIRT1178982	hsa-miR-323-3p	CLIP-seq
MIRT1178983	hsa-miR-338-5p	CLIP-seq
MIRT1178984	hsa-miR-3607-3p	CLIP-seq
MIRT1178985	hsa-miR-3678-5p	CLIP-seq
MIRT1178986	hsa-miR-370	CLIP-seq
MIRT1178987	hsa-miR-3978	CLIP-seq
MIRT1178988	hsa-miR-4652-3p	CLIP-seq
MIRT1178989	hsa-miR-4764-3p	CLIP-seq
MIRT1178990	hsa-miR-4768-5p	CLIP-seq
MIRT1178991	hsa-miR-494	CLIP-seq
MIRT1178992	hsa-miR-515-5p	CLIP-seq
MIRT1178993	hsa-miR-548k	CLIP-seq
MIRT1178994	hsa-miR-548n	CLIP-seq
MIRT1178995	hsa-miR-548u	CLIP-seq
MIRT1178996	hsa-miR-570	CLIP-seq
MIRT1178997	hsa-miR-875-3p	CLIP-seq
MIRT1178998	hsa-miR-1202	CLIP-seq
MIRT1178999	hsa-miR-3972	CLIP-seq
MIRT1179000	hsa-miR-4317	CLIP-seq
MIRT2051763	hsa-miR-3646	CLIP-seq
MIRT1178998	hsa-miR-1202	CLIP-seq
MIRT2280899	hsa-miR-2682	CLIP-seq
MIRT1178999	hsa-miR-3972	CLIP-seq
MIRT1179000	hsa-miR-4317	CLIP-seq
MIRT2280900	hsa-miR-4423-3p	CLIP-seq
MIRT2280901	hsa-miR-449c	CLIP-seq
MIRT2280902	hsa-miR-940	CLIP-seq
MIRT1178995	hsa-miR-548u	CLIP-seq
MIRT1178978	hsa-miR-1287	CLIP-seq
MIRT1178979	hsa-miR-1976	CLIP-seq
MIRT1178980	hsa-miR-3135b	CLIP-seq
MIRT1178986	hsa-miR-370	CLIP-seq
MIRT1178987	hsa-miR-3978	CLIP-seq
MIRT2579321	hsa-miR-4733-5p	CLIP-seq
MIRT2579322	hsa-miR-548aa	CLIP-seq
MIRT2579323	hsa-miR-577	CLIP-seq
MIRT1178997	hsa-miR-875-3p	CLIP-seq
MIRT1178978	hsa-miR-1287	CLIP-seq
MIRT1178979	hsa-miR-1976	CLIP-seq
MIRT1178980	hsa-miR-3135b	CLIP-seq
MIRT1178986	hsa-miR-370	CLIP-seq
MIRT1178987	hsa-miR-3978	CLIP-seq
MIRT1178988	hsa-miR-4652-3p	CLIP-seq
MIRT1178989	hsa-miR-4764-3p	CLIP-seq
MIRT1178996	hsa-miR-570	CLIP-seq
MIRT2579323	hsa-miR-577	CLIP-seq
MIRT1178997	hsa-miR-875-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603840	7699	ENSG00000065518

O95168

Protein name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Complex I-B15) (CI-B15) (NADH-ubiquinone oxidoreductase B15 subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07225	NDUF_B4	5 → 128	NADH-ubiquinone oxidoreductase B15 subunit (NDUFB4)	Family

Sequence

MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLI
ENPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK
LDRTFHLSY

Sequence length

129

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10651741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	10651741, 1299245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	6746903	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	3578273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	6594040	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38042639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22784404	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37653517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33607292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27268619	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NDUFB4 (NADH:ubiquinone oxidoreductase subunit B4)