Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4708
Gene name	NADH:ubiquinone oxidoreductase subunit B2
Gene symbol	NDUFB2
Synonyms (NCBI Gene)	AGGGCI-AGGG
Chromosome	7
Chromosome location	7q34
Summary	The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a im

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031131	hsa-miR-19b-3p	Sequencing	20371350
MIRT440127	ebv-miR-BART13-3p	HITS-CLIP	22473208
MIRT440125	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT440127	ebv-miR-BART13-3p	HITS-CLIP	22473208
MIRT440125	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT1178960	hsa-miR-1229	CLIP-seq
MIRT1178961	hsa-miR-149	CLIP-seq
MIRT1178962	hsa-miR-19a	CLIP-seq
MIRT1178963	hsa-miR-19b	CLIP-seq
MIRT1178964	hsa-miR-203	CLIP-seq
MIRT1178965	hsa-miR-3622a-3p	CLIP-seq
MIRT1178966	hsa-miR-3622b-3p	CLIP-seq
MIRT1178967	hsa-miR-362-5p	CLIP-seq
MIRT1178968	hsa-miR-4517	CLIP-seq
MIRT1178969	hsa-miR-4775	CLIP-seq
MIRT1178970	hsa-miR-4797-5p	CLIP-seq
MIRT1178971	hsa-miR-500a	CLIP-seq
MIRT1178972	hsa-miR-500b	CLIP-seq
MIRT1178973	hsa-miR-526b	CLIP-seq
MIRT1178974	hsa-miR-643	CLIP-seq
MIRT1178975	hsa-miR-760	CLIP-seq
MIRT1178960	hsa-miR-1229	CLIP-seq
MIRT1178961	hsa-miR-149	CLIP-seq
MIRT1178965	hsa-miR-3622a-3p	CLIP-seq
MIRT1178966	hsa-miR-3622b-3p	CLIP-seq
MIRT1178974	hsa-miR-643	CLIP-seq
MIRT1178975	hsa-miR-760	CLIP-seq
MIRT1178960	hsa-miR-1229	CLIP-seq
MIRT1178961	hsa-miR-149	CLIP-seq
MIRT1178962	hsa-miR-19a	CLIP-seq
MIRT1178963	hsa-miR-19b	CLIP-seq
MIRT1178964	hsa-miR-203	CLIP-seq
MIRT2280881	hsa-miR-2467-5p	CLIP-seq
MIRT2280882	hsa-miR-3188	CLIP-seq
MIRT2280883	hsa-miR-3618	CLIP-seq
MIRT1178965	hsa-miR-3622a-3p	CLIP-seq
MIRT1178966	hsa-miR-3622b-3p	CLIP-seq
MIRT1178967	hsa-miR-362-5p	CLIP-seq
MIRT2280884	hsa-miR-3929	CLIP-seq
MIRT2280885	hsa-miR-3975	CLIP-seq
MIRT2280886	hsa-miR-4316	CLIP-seq
MIRT2280887	hsa-miR-4419b	CLIP-seq
MIRT2280888	hsa-miR-4478	CLIP-seq
MIRT1178968	hsa-miR-4517	CLIP-seq
MIRT1178969	hsa-miR-4775	CLIP-seq
MIRT1178970	hsa-miR-4797-5p	CLIP-seq
MIRT2280889	hsa-miR-485-5p	CLIP-seq
MIRT1178971	hsa-miR-500a	CLIP-seq
MIRT1178972	hsa-miR-500b	CLIP-seq
MIRT1178973	hsa-miR-526b	CLIP-seq
MIRT2280890	hsa-miR-627	CLIP-seq
MIRT1178974	hsa-miR-643	CLIP-seq
MIRT2280891	hsa-miR-759	CLIP-seq
MIRT1178975	hsa-miR-760	CLIP-seq
MIRT2280892	hsa-miR-924	CLIP-seq
MIRT1178962	hsa-miR-19a	CLIP-seq
MIRT1178963	hsa-miR-19b	CLIP-seq
MIRT1178968	hsa-miR-4517	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603838	7697	ENSG00000090266

O95178

Protein name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial (Complex I-AGGG) (CI-AGGG) (NADH-ubiquinone oxidoreductase AGGG subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14813	NADH_B2	37 → 104	NADH dehydrogenase 1 beta subcomplex subunit 2	Family

Sequence

MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEF
FSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

Sequence length

105

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37545529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17869652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	24966028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27154175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	17869652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36860730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	22816799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	22816799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22140517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	38181234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14754878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27154175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	15802318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14754878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	28714002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	38181234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NDUFB2 (NADH:ubiquinone oxidoreductase subunit B2)