Gene Gene information from NCBI Gene database.
Entrez ID 4700
Gene name NADH:ubiquinone oxidoreductase subunit A6
Gene symbol NDUFA6
Synonyms (NCBI Gene)
B14CI-B14LYRM6MC1DN33NADHB14
Chromosome 22
Chromosome location 22q13.2
Summary This gene encodes a member of the LYR family of proteins that contain a highly conserved tripeptide (LYR) motif near the N-terminus. The encoded protein is an accessory subunit of NADH: ubiquinone oxidorerductase (Complex I), which is the largest enzyme o
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs750830935 C>G,T Pathogenic Coding sequence variant, missense variant
rs758833609 C>A,T Pathogenic Coding sequence variant, missense variant, stop gained
rs763006208 A>- Pathogenic Frameshift variant, coding sequence variant
rs781099275 G>- Pathogenic Frameshift variant, coding sequence variant
rs1569463838 CT>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
194
miRTarBase ID miRNA Experiments Reference
MIRT549542 hsa-miR-3174 PAR-CLIP 20371350
MIRT549541 hsa-miR-520f-5p PAR-CLIP 20371350
MIRT549540 hsa-miR-591 PAR-CLIP 20371350
MIRT549539 hsa-miR-1301-5p PAR-CLIP 20371350
MIRT549538 hsa-miR-6502-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IDA 28844695
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602138 7690 ENSG00000184983
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P56556
Protein name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (Complex I-B14) (CI-B14) (LYR motif-containing protein 6) (NADH-ubiquinone oxidoreductase B14 subunit)
Protein function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Required for proper complex I assembly (PubMed:30245030). Complex I functions in the transfer of
PDB 5XTB , 5XTD , 5XTH , 5XTI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05347 Complex1_LYR 30 92 Complex 1 protein (LYR family) Family
Sequence
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR
DKVREMFMKNAHVTDPRVVDLLVIKGKIELEE
TIKVWKQRTHVMRFFHETEAPRPKDFLS
KFYVGHDP
Sequence length 128
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
  Respiratory electron transport
Complex I biogenesis
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Mitochondrial complex I deficiency, nuclear type 33 Pathogenic; Likely pathogenic rs1569463838, rs758833609, rs750830935, rs1023075742, rs781099275, rs763006208 RCV000709999
RCV000709998
RCV000709997
RCV000710000
RCV000710002
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mitochondrial disease Pathogenic; Likely pathogenic rs1569463838, rs758833609, rs750830935, rs1023075742, rs781099275, rs763006208 RCV000680374
RCV000680372
RCV000680371
RCV000680370
RCV000680375
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NDUFA6-related disorder Likely pathogenic rs763006208 RCV004758045
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MITOCHONDRIAL COMPLEX I DEFICIENCY Disgenet, Orphanet
Disgenet, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Bipolar Disorder Bipolar Disorder BEFREE 25726893
★☆☆☆☆
Found in Text Mining only
Blepharoptosis Ptosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebellar Hypoplasia Cerebellar Hypoplasia HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency Congenital adrenal hyperplasia Pubtator 18187875, 3001309 Associate
★☆☆☆☆
Found in Text Mining only
Deglutition Disorders Dysphagia HPO_DG
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes Mellitus HPO_DG
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 1 Diabetes mellitus, type 1 Pubtator 31127057 Stimulate
★☆☆☆☆
Found in Text Mining only
Encephalopathies Epileptic encephalopathy HPO_DG
★☆☆☆☆
Found in Text Mining only
Global developmental delay Developmental Delay HPO_DG
★☆☆☆☆
Found in Text Mining only
Hemochromatosis Hemochromatosis Pubtator 3475981 Associate
★☆☆☆☆
Found in Text Mining only