NCAM1 (neural cell adhesion molecule 1)

Gene

• Entrez ID: 4684
• Gene name: Neural cell adhesion molecule 1
• Gene symbol: NCAM1
• Synonyms (NCBI Gene): CD56, MSK39, NCAM
• Chromosome: 11
• Chromosome location: 11q23.2
• Summary: This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein pla

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003090	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR	19296470
MIRT003159	hsa-miR-210-3p	immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR	19826008
MIRT006773	hsa-miR-200c-3p	Luciferase reporter assay	22707408
MIRT019976	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT003090	hsa-miR-122-5p	Microarray	17179747
MIRT003090	hsa-miR-122-5p	Microarray	17612493
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT731768	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26255203
MIRT1175644	hsa-miR-1284	CLIP-seq
MIRT1175645	hsa-miR-300	CLIP-seq
MIRT1175646	hsa-miR-381	CLIP-seq
MIRT1175647	hsa-miR-4323	CLIP-seq
MIRT1175648	hsa-miR-4329	CLIP-seq
MIRT1175649	hsa-miR-4663	CLIP-seq
MIRT1175650	hsa-miR-4666-3p	CLIP-seq
MIRT1175651	hsa-miR-4728-3p	CLIP-seq
MIRT1175652	hsa-miR-942	CLIP-seq
MIRT1175653	hsa-miR-204	CLIP-seq
MIRT1175654	hsa-miR-211	CLIP-seq
MIRT1175655	hsa-miR-3119	CLIP-seq
MIRT1175656	hsa-miR-3136-5p	CLIP-seq
MIRT1175657	hsa-miR-3163	CLIP-seq
MIRT1175658	hsa-miR-361-3p	CLIP-seq
MIRT1175659	hsa-miR-3614-5p	CLIP-seq
MIRT1175660	hsa-miR-3679-3p	CLIP-seq
MIRT1175661	hsa-miR-3686	CLIP-seq
MIRT1175662	hsa-miR-4286	CLIP-seq
MIRT1175648	hsa-miR-4329	CLIP-seq
MIRT1175663	hsa-miR-4439	CLIP-seq
MIRT1175664	hsa-miR-4446-5p	CLIP-seq
MIRT1175665	hsa-miR-4513	CLIP-seq
MIRT1175666	hsa-miR-4652-3p	CLIP-seq
MIRT1175649	hsa-miR-4663	CLIP-seq
MIRT1175667	hsa-miR-4713-5p	CLIP-seq
MIRT1175651	hsa-miR-4728-3p	CLIP-seq
MIRT1175668	hsa-miR-4742-3p	CLIP-seq
MIRT1175669	hsa-miR-4755-5p	CLIP-seq
MIRT1175670	hsa-miR-4766-5p	CLIP-seq
MIRT1175671	hsa-miR-548c-3p	CLIP-seq
MIRT1175672	hsa-miR-548g	CLIP-seq
MIRT1175673	hsa-miR-548l	CLIP-seq
MIRT1175674	hsa-miR-561	CLIP-seq
MIRT1175675	hsa-miR-623	CLIP-seq
MIRT1175676	hsa-miR-943	CLIP-seq
MIRT1175648	hsa-miR-4329	CLIP-seq
MIRT1175649	hsa-miR-4663	CLIP-seq
MIRT1175651	hsa-miR-4728-3p	CLIP-seq
MIRT1175677	hsa-miR-4731-3p	CLIP-seq
MIRT1175678	hsa-miR-4801	CLIP-seq
MIRT2050849	hsa-miR-4777-5p	CLIP-seq
MIRT1175653	hsa-miR-204	CLIP-seq
MIRT1175654	hsa-miR-211	CLIP-seq
MIRT1175644	hsa-miR-1284	CLIP-seq
MIRT1175645	hsa-miR-300	CLIP-seq
MIRT1175646	hsa-miR-381	CLIP-seq
MIRT1175647	hsa-miR-4323	CLIP-seq
MIRT1175650	hsa-miR-4666-3p	CLIP-seq
MIRT1175668	hsa-miR-4742-3p	CLIP-seq
MIRT1175652	hsa-miR-942	CLIP-seq
MIRT2431504	hsa-miR-3140-3p	CLIP-seq
MIRT2454900	hsa-miR-1285	CLIP-seq
MIRT2454901	hsa-miR-141	CLIP-seq
MIRT2454902	hsa-miR-200a	CLIP-seq
MIRT2454903	hsa-miR-30a	CLIP-seq
MIRT2454904	hsa-miR-30b	CLIP-seq
MIRT2454905	hsa-miR-30c	CLIP-seq
MIRT2454906	hsa-miR-30d	CLIP-seq
MIRT2454907	hsa-miR-30e	CLIP-seq
MIRT2454908	hsa-miR-3187-5p	CLIP-seq
MIRT2454909	hsa-miR-371b-5p	CLIP-seq
MIRT2454910	hsa-miR-378g	CLIP-seq
MIRT2454911	hsa-miR-4314	CLIP-seq
MIRT2454912	hsa-miR-4437	CLIP-seq
MIRT2454913	hsa-miR-4486	CLIP-seq
MIRT2454914	hsa-miR-4674	CLIP-seq
MIRT2454915	hsa-miR-4715-5p	CLIP-seq
MIRT2454916	hsa-miR-522	CLIP-seq
MIRT2454917	hsa-miR-570	CLIP-seq
MIRT2454918	hsa-miR-612	CLIP-seq
MIRT2454919	hsa-miR-875-3p	CLIP-seq
MIRT2578529	hsa-miR-1226	CLIP-seq
MIRT2578530	hsa-miR-4733-3p	CLIP-seq
MIRT2578531	hsa-miR-1271	CLIP-seq
MIRT2578532	hsa-miR-135a	CLIP-seq
MIRT2578533	hsa-miR-135b	CLIP-seq
MIRT2578534	hsa-miR-18a	CLIP-seq
MIRT2578535	hsa-miR-18b	CLIP-seq
MIRT2578536	hsa-miR-2681	CLIP-seq
MIRT2578537	hsa-miR-27a	CLIP-seq
MIRT2578538	hsa-miR-27b	CLIP-seq
MIRT2578539	hsa-miR-3117-5p	CLIP-seq
MIRT2578540	hsa-miR-3131	CLIP-seq
MIRT2578541	hsa-miR-3169	CLIP-seq
MIRT2578542	hsa-miR-328	CLIP-seq
MIRT2578543	hsa-miR-4735-3p	CLIP-seq
MIRT2578544	hsa-miR-4740-5p	CLIP-seq
MIRT1175670	hsa-miR-4766-5p	CLIP-seq
MIRT2578545	hsa-miR-513a-5p	CLIP-seq
MIRT2578546	hsa-miR-611	CLIP-seq
MIRT2578547	hsa-miR-96	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF9	Activation	17431130
NFKB1	Activation	19091137
PAX2	Unknown	16406048;19485921
PAX8	Activation	8071351
RELA	Activation	19091137
RUNX1	Activation	16892559
SOX4	Activation	20049565

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001618	Function	Virus receptor activity	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3576199
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	10770948
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0009986	Component	Cell surface	IDA	10766765
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3576199
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0043005	Component	Neuron projection	IBA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0071679	Process	Commissural neuron axon guidance	ISS
GO:0098552	Component	Side of membrane	IEA
GO:2001260	Process	Regulation of semaphorin-plexin signaling pathway	ISS

Other IDs

• MIM: 116930
• HGNC: 7656
• e!Ensembl: ENSG00000149294

Protein

• UniProt ID: P13591
• Protein name: Neural cell adhesion molecule 1 (N-CAM-1) (NCAM-1) (CD antigen CD56)
• Protein function: This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.; (Microbial infection) Acts as a receptor for rabies virus. ; (Micro
• PDB: 2E3V, 2HAZ, 2VKW, 2VKX, 3MTR, 5AEA, 5LKN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	20 → 114	Immunoglobulin I-set domain	Domain
  PF13927	Ig_3	119 → 192		Domain
  PF07679	I-set	214 → 304	Immunoglobulin I-set domain	Domain
  PF13927	Ig_3	307 → 399		Domain
  PF07679	I-set	418 → 505	Immunoglobulin I-set domain	Domain
  PF00041	fn3	508 → 598	Fibronectin type III domain	Domain
  PF00041	fn3	610 → 696	Fibronectin type III domain	Domain

• Sequence:

  MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
  KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF
  KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
  KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF
  PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI
  HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE
  KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG
  PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDS
  ENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI
  LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAA
  SEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI
  RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLS
  TGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFS
  KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE
  VKTVPNDATQTKENESKA

• Sequence length: 858

Pathways

KEGG:

Virion - Ebolavirus, Lyssavirus and Morbillivirus
Cell adhesion molecules
Prion disease

Reactome:

NCAM signaling for neurite out-growth
NCAM1 interactions
Signal transduction by L1
RAF/MAP kinase cascade
Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	29890543		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10914547, 12010820, 12953810, 9310493		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11279625, 12008081, 15626024, 27734763		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	25361478		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10583228, 11835327, 15289011, 17662713, 20694842, 21156247, 29862539, 30814062, 31765481, 9269784		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	10391105		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11835333, 15108165, 15193442, 24206578, 26183877, 30322324		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11263866, 22261536, 23441128, 26482608		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26428847		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	17982624		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11279625, 12008081, 15626024, 29161980		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	15289011, 24782118		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10504545, 24294395		★☆☆☆☆ Found in Text Mining only
Adult onset autosomal dominant leukodystrophy	Leukodystrophy	BEFREE	19725832		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10599307, 24676459		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23747161		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	24427371		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20164549, 30578620, 36635346	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	25889612, 34175884	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28454452, 31194501		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25619885		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	25637056	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	7786771		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	33103514, 38386917	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	34741163	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	25032754		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16323244, 24100919	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17195207, 32246007, 32365786	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12061423, 16883065, 26587832, 37865742	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	2039710	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	1975092		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	1975092	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	30322324		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	22832519, 25989180, 30529763	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21606926, 22832519		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30320048, 30423390		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	11450817, 25137309, 27023175		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	25137309, 36199823	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16946717		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26147463, 27157273	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10879740, 16456318, 19504395, 24294395, 31159947		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17635242		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	19719835		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10594567, 16237110, 17334044	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	26937142	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11353453, 15050861, 17413444, 24651862		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15050861, 17239033, 17413444, 21515372, 24651862		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	17413444		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	17413444, 24651862, 29197740	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	9169661		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	11049976	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	11943714	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19222860, 29415975	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	18698520	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	17216340		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	1867319, 2039710	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25921109	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30243716, 31217484, 9259972		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23359508	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31217484, 33066779, 35372457, 7629288	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	11263866		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29327714		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	29327714, 29764843	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	1856291, 30383875	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	20640606	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11263866, 11740050, 27984374, 28972818, 31374137		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	35372457	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11050046, 22732936, 24452951, 25926643, 26437631, 34092607, 37056756, 37254046, 40547009	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	26040463, 35372457	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	16862075, 34996493	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	34896889	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22463390		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19568411, 20462442, 24817936	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16862075, 34397927	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	21203907, 22509088	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18594005, 28528398, 33933015	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19719835, 28403527		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	18805740, 31390635, 31584482		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23877403, 30410679		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	31040050		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	12937148		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12937148		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26147463	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	17511112		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	32664812	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30237546		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12008081, 15626024		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	17662713, 31294507		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20503460	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22707408, 31186529	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	27381730	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28938700		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	36059513	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	11729215	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	11729215	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	1682391, 30949182	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	28028749, 28431200, 30371512		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	12008081		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	LHGDN	12008081		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20164549, 34285142, 35492247	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19737136	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33295628	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	8915691	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20591136	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23349906, 28440449, 31493232, 31636738		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14968119, 20591136, 24348178, 25997610, 34937729, 8396566	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10971518	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	25295286		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	25295286	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	23274669, 24397461, 27208430, 28335588		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10354139, 11480556, 12189644, 14692523, 19629629		★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	18553158	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21212386, 28870505		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28414590, 29506702		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11882051	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28414590, 29506702		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28414590, 29506702		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33295628, 8915691	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	40182599	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28668542		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	36421848	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	24448401	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	PSYGENET_DG	21939373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	14985425, 17409734, 18973581, 22361116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	27913255, 28334615, 31185929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	31185929, 40226707	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	38302650	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	11564368		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	1867319	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	BEFREE	30320048		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28315934		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27294162	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28315934		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29236750	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	25793768, 29236750, 32500117	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36099092	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27294162, 30451213	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28427244, 37082729	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25793768		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28427244, 30050458, 30451213, 30576948, 31440251		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	34899600	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36211816	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	23015367		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10504545, 24294395, 29247708		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	11939742, 24206578		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	24206578	Stimulate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	17261181, 23496965	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17043020		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	17043020		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25701644	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesia Familial with Facial Myokymia	Dyskinesia, familial, with facial myokymia	Pubtator	21079332	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29133142		★☆☆☆☆ Found in Text Mining only
Endometrial stromal sarcoma, high grade	Endometrial Stromal Sarcoma	BEFREE	30252726		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15833103, 30021652		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24807109, 31655348, 34539624, 38375785	Associate	★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	17511112, 21323966, 26226842		★☆☆☆☆ Found in Text Mining only
Epilepsy Rolandic	Rolandic epilepsy	Pubtator	26045862	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27317650	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27317650	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30770960		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	29165313		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	16006137		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24240977		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24240977		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	20064266, 21619669, 26370228, 27098723, 27245705	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	29867995	Stimulate	★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	29090365	Inhibit	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30193772		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	20640858, 28214214, 29799356		★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	32146798	Associate	★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	29799356		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	34587219	Inhibit	★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	LHGDN	18213713		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	LHGDN	18213713		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	26463893		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	40226707	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	36753304	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	18334877		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	10354139, 10879740, 11253136, 11328295, 11971211, 12015765, 12478682, 15466379, 15832009, 19375652, 19652428, 23365458, 23426534, 27409423, 35371002, 7517211, 8608237, 9409191	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	30468481	Stimulate	★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	33811445	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18490770, 19288188, 20308310, 26943771	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20308310, 22472177, 26943771, 9815731		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20308310, 22472177, 26943771, 9815731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	18492260, 22076165, 7506810	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32085673	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26743340	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	33968049	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	26550777, 28131632, 30235723		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	27624647	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	25281394		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	7527744	Stimulate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	16311729, 31256601		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	29541194, 29799356		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18973919	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21212386, 28870505		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21212386	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	17018683	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10504545, 12925986, 25779340, 26164398, 9169661		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12483012, 12925986, 25201755	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	25201755		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	23881915	Associate	★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	10583121		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	19085952	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27091211	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	11050046	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24942856	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	11854929	Inhibit	★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	17979491, 20694842		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	9261474		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17187781, 17400200		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	23887161, 27744503, 28214214		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	22186713	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	27571524		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	28212403	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21212386	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	12937148		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	21212386	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	20844484		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36093941, 9667649	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29090365	Inhibit	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	16480433, 16946717, 31669825		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	24807109	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	25628040		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36571819	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	30851202		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	17511112, 18801082		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30349952		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	34741163, 40226707	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	12937148, 23462508		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	24760111		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	10571346, 11493472, 24676459, 9578080		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	24055371		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24353323	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	24817936	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	GWASCAT_DG	21212386		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10800166, 11401089, 11408070, 11488062, 12008081, 12189644, 1372833, 14712486, 16986129, 17043020, 17875504, 29237977, 30814062, 3248386, 8639431, 9269784, 9326190		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11342451, 11835333, 16986129, 16998465, 17157162, 25596273, 25794001, 26706848, 31719049, 7517211, 9257883, 9269784	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17043020		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	16311729	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	14726391	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10025733, 10354136, 10583228, 11835327, 12010820, 12483012, 12562262, 15388576, 16986129, 17431130, 18061959, 19781775, 24528030, 24762509, 26706848, 31171000, 31212079, 31294507, 31765481, 32212802, 33054115, 33526873, 33594945, 33811445, 33928145, 34050021, 34432318, 36544113, 37458189, 7517211, 9269784, 9310493, 9395193	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32865882	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	33108455	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	17068154, 17550865	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11835333, 15108165, 21148082, 24206578, 25045197, 27077772, 32847610, 36629681, 37584196, 7517211	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	11757730, 14737071, 15466379, 16549811, 30624264, 7522625		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10354136, 10583228, 10914547, 11480556, 11835327, 12189644, 12682630, 1372833, 14692523, 15068897, 15142118, 15289011, 16456318, 16986129, 17431130, 17662713, 17875504, 18333845, 18715689, 19205620, 19283381, 19568712, 19629629, 19781775, 20694842, 21156247, 22939316, 24762509, 24782118, 28133918, 28321813, 29660158, 29862539, 30814062, 31171000, 31256601, 31294507, 31765481, 7514247, 7517211, 9169661, 9269784, 9368483		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	14959847, 18333845		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10222657		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	40263987	Associate	★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	19725832	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28977911, 9178839, 9869207		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15585621, 21304407, 26437631, 28938700, 29568203		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	11050046	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27208430		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	24759184	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	15634930	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24942856	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	17195207	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	1337798, 2165922, 25520133, 35836920	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25921109	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29360191, 30154579		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18564343	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23956418, 27847409, 8403494	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27424138, 35172900	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24760111, 8912506		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25394353, 38006863	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	35876164, 9920853	Associate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	15466379, 27665844, 9519776		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	28413901	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	10583121, 11756153		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10048432, 10328090, 10354139, 10583121, 10800166, 10828627, 10879740, 10955685, 11048978, 11066052, 11328295, 11401089, 11488062, 11911423, 12533686, 12653743, 15139996, 17052504, 18005171, 18370955, 19641183, 21323966, 21502955, 22562117, 22690710, 24094496, 29237977, 29327714, 31041299, 7485082, 7512851, 7520016, 7530849, 7532919, 8608237, 9261474, 9326190, 9470917, 9521469, 9578080, 9869207		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10803703, 10955685, 11337356, 11696428, 12548603, 1373974, 14592815, 15790718, 15968729, 17018683, 17891925, 19109214, 21274672, 2174895, 23583640, 7524749, 8702007, 9217183, 9811340	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	29237977	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	31273513	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	18237230, 28877678, 29761078		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	31273513		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11587224, 12925986, 25769453, 8985084		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11587224, 25769453		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18005171		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	12150138, 17052504, 30957244		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	11566350, 15270596, 7530849		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	14726391, 17018683, 22105417	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29165313	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	15050861		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	15050861		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	15050861		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	15050861		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	15050861		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	15050861		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	15050861		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18068248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	23359508, 30243716, 31217484, 9259972		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22463390		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23877403, 27984374, 30410679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21535078, 26624980, 31430659		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25860484		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23015367		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11342451, 12010820, 12651068, 12908783, 14754607, 15054822, 15139996, 17645781, 19246644, 22225776, 22449227, 23760992, 26186733, 28131632, 28159518, 28215306, 28620927, 29622795, 29799356, 3036723, 30624264, 31661725, 7512851, 7520016, 9269784, 9310493, 9546748		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	17300669		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	36759849	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	2039710	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12202905, 33721450, 34454530, 37563418	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12964006		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15889254	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32231660	Inhibit	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	26460482	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	14985425, 17409734, 18973581, 22361116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	27913255, 28334615, 31185929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	16229822, 24651862		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	LHGDN	12727026		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	28403527, 31031215		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31419253		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	22732936	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	11775253		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	9920853		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	11925408, 23739222, 29396049, 31317282		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15049904, 20096010, 29372735, 8833394, 9264387, 9583896		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	15050861, 17409734		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	15050861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	15050861, 17409734		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	BEFREE	29215920		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	23298273		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10027726, 10848782, 10911386, 11841427, 11943714, 11948796, 12060125, 14531906, 15578069, 16728278, 1695113, 1706237, 18275432, 18553158, 20438295, 21634008, 23019187, 23818359, 24133602, 28270374, 29316245, 29738534, 30146632, 31140731, 35380709, 36221376, 36564753, 39493694, 7579410, 8490175, 8797890, 9649209	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10911386, 11841427, 14531906, 14692531, 15049904, 15739024, 17891186, 19201468, 19235015, 20049565, 20096010, 21724429, 22423624, 23927993, 28454452, 28521480, 29372735, 29920491, 30340993, 30344721, 30542145, 8833394, 9436925, 9583896, 9920853		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15061198, 18231917		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27734595, 7522634	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35882000	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18062798, 19304328, 21079332, 21212154, 21622858, 25218211, 26381393, 27157273, 27162345, 8852513, 9119974	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19203081, 19304328, 19758707, 24092328, 27157273, 28332001, 28555437		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	3295121	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	29194448	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	23272181	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29194448		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	16946717		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	23734938		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11775253, 23734938, 25637056, 9169661		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25637056, 32179638, 33369070, 35775392	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	25637056		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	17043020, 23810283, 24676459, 9269784		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11777957, 31695700, 9169661		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	19201468, 30523401		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	21967803, 31185929		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	21967803	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	LHGDN	16892559		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	12937148		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	LHGDN	16534119		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	15146016	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27294162	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	2832545	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	16456318, 18237230, 18370955, 21867533, 25188863, 29258904, 30470245, 7532919, 8834518		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31390635		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10663610, 11235901, 12908783, 12925986, 12964006, 14745729, 14754607, 14968119, 15256054, 15744340, 16456318, 16633070, 16838325, 16941013, 17300669, 17573672, 17632456, 17899696, 18927318, 19158833, 19246644, 19283849, 19504395, 19772585, 20083228, 20511669, 21567084, 21923812, 22056974, 22225776, 22241735, 22895265, 23239665, 23302373, 23441128, 23455181, 24427371, 24436244, 2461089, 25188863, 25683635, 25779340, 25937368, 26428847, 26743477, 27020553, 27342913, 27984374, 28159518, 28349943, 28403527, 28454377, 28621318, 28858396, 29064025, 29220096, 29533277, 29533280, 29572766, 29622795, 29848524, 30171991, 30252726, 30523500, 30675205, 30770960, 31373070, 31417937, 31477684, 31691383, 31765481, 7829236, 8387835, 8751472, 8833394, 8985084, 9222276, 9255261, 9261474, 9521469, 9578080, 9989839		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	LHGDN	15246157		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20187302, 23239665, 2461089, 25068119, 28729402, 31202518		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27571524		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	15883837		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	15883837, 17550865	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	29848524		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12497591, 12521134, 14616785, 15256054, 17181871, 1856291, 18630512, 1867319, 19222860, 20145268, 2039710, 23472067, 2471777, 31316758, 31638925, 37947594, 39512342	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12767104, 15256054, 17181871, 17505515, 18630512, 20145268, 21567084, 22463390, 26463893, 28159518, 28622272, 29622795, 30237546, 3036723, 30824689, 31638925, 8640845		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17699847, 28719469, 28982917, 29390385, 30480372, 30502379, 31169696		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	32914879	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28977911, 9178839, 9869207		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23441128, 29158791, 29566943		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24348178	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	31440251		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oligodendroglioma	Oligodendroglioma	Pubtator	2039710	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28668542, 37973964	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	32636407	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	31533814	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	11943714	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30410679		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16907986	Inhibit	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23877403		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12202905, 1867319	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18384787		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17317933, 34389782	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	14726964, 17317933	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17573672, 20640858, 22225776, 28214214, 29541194, 29799356, 29890543, 29951933		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31068198	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34768133	Stimulate	★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	32068473	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	16946717, 18373702	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31353867		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31353867		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10571346, 10879740, 10976700, 1373974, 15794680, 18370955, 25188863, 7520016, 8387835, 8608237, 9578080		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	10793072	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	36119051	Inhibit	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30423390		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	23785438	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31655798	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	34257554	Inhibit	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	11911423, 26091716, 27665844		★☆☆☆☆ Found in Text Mining only
Pleuropulmonary blastoma	Pleuropulmonary blastoma	BEFREE	31477684		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20236632	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	28336415		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	29144828		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12008081, 15626024, 27734763		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12008081, 14959847, 15626024		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30028023		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	30542145		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	24462038		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	24744588		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21535078, 26624980, 31430659		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21535078, 32512818, 33569050, 36572885	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28212403		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26563434		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20529083, 23505535, 25078269, 26423011	Associate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	28518224	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	25637056		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26031603		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	10828627, 11048978		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	9222276		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	19039198	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	24427371	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	1867319	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21536152, 24397353, 8808638		★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathies	Pubtator	10397078	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	12937148, 15994392		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	15994392, 36613701	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18425046		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	1867319	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	25921109	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	9543674		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	24293381	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	32439742	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	32914879	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	11681838, 17413444		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	17161382, 17413444, 18601968, 19411161, 24651862, 25445624, 29898582, 30664618, 9154219		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	17413444, 26460482, 34667143, 35492247, 37552420	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21515372, 24057454, 25445624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	20591136, 29354119		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30114952		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	24661133		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	26550777		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	11911423, 12051636, 18654739, 21536152, 28518224		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	12576313, 17018683	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21923812		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	15863638	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19179901, 19228643, 23530560, 26482608, 28341109, 28349943, 29435172, 29566943, 29622795, 29630426, 29787820, 29937242, 30154579, 30385371, 7539317		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1325302, 1337798, 15926079, 1701450, 19179901, 2165922, 28349943, 31161851, 35402616, 36869231, 37011997, 7506925	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	3295121	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23441128, 28403126, 30914778		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18547033, 36378845, 37090107	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	11263866		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28215306		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19319529, 29960819		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	31419253		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25860484, 30448221		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25860484, 27270314	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27409423	Inhibit	★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	17052504, 24815502, 31595546, 9669350		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	28518224		★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	11757730, 14712486, 15466379, 18055343, 30624264, 7522625, 8751472, 9178839		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10664622, 10828627, 10879740, 10955685, 11956825, 12051636, 12150138, 12432997, 15794680, 16456318, 18370955, 18654739, 18801082, 24427371, 7520016, 9261474, 9359478, 9681817, 9858215		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	34782049	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	12060125	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23159288, 24715165, 25372417, 26097548, 26186733	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23324246	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23015367		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	25372417, 30173227, 32146798	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	28214214, 29799356		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Oncocytic Adenoma	Thyroid Gland Oncocytic Adenoma	BEFREE	28214214		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23015367		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	29890543		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	7527744	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	26045862	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26460482, 36161312, 36412444, 39643914	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	18068248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25921109	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36583228	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	29763719		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35008799	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33087896, 35008799	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	30105034	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	16456318		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	15246157, 19696931, 2461089, 2849302, 30155617	Associate	★☆☆☆☆ Found in Text Mining only
Wolman Disease	Wolman Disease	BEFREE	9126667		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	19719835		★☆☆☆☆ Found in Text Mining only