Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4682
Gene name	NUBP iron-sulfur cluster assembly factor 1, cytosolic
Gene symbol	NUBP1
Synonyms (NCBI Gene)	CIAO5NBPNBP1NBP35
Chromosome	16
Chromosome location	16p13.13
Summary	NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).[supplied by OMIM, Mar 2008]

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020454	hsa-miR-106b-5p	Microarray	17242205
MIRT048800	hsa-miR-93-5p	CLASH	23622248
MIRT042522	hsa-miR-423-3p	CLASH	23622248
MIRT039853	hsa-miR-615-3p	CLASH	23622248
MIRT573118	hsa-miR-1203	PAR-CLIP	20371350
MIRT573117	hsa-miR-4487	PAR-CLIP	20371350
MIRT573116	hsa-miR-6131	PAR-CLIP	20371350
MIRT073754	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT073755	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT073761	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT073758	hsa-miR-3123	PAR-CLIP	21572407
MIRT555954	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT073762	hsa-miR-4744	PAR-CLIP	21572407
MIRT555953	hsa-miR-4509	PAR-CLIP	21572407
MIRT073757	hsa-miR-938	PAR-CLIP	21572407
MIRT073764	hsa-miR-6886-3p	PAR-CLIP	21572407
MIRT073763	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT555952	hsa-miR-4732-5p	PAR-CLIP	21572407
MIRT073753	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555951	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT555950	hsa-miR-6083	PAR-CLIP	21572407
MIRT073760	hsa-miR-3674	PAR-CLIP	21572407
MIRT573118	hsa-miR-1203	PAR-CLIP	20371350
MIRT573117	hsa-miR-4487	PAR-CLIP	20371350
MIRT573116	hsa-miR-6131	PAR-CLIP	20371350
MIRT073754	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT073755	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT073761	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT073758	hsa-miR-3123	PAR-CLIP	21572407
MIRT555954	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT073762	hsa-miR-4744	PAR-CLIP	21572407
MIRT555953	hsa-miR-4509	PAR-CLIP	21572407
MIRT073757	hsa-miR-938	PAR-CLIP	21572407
MIRT073764	hsa-miR-6886-3p	PAR-CLIP	21572407
MIRT073763	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT555952	hsa-miR-4732-5p	PAR-CLIP	21572407
MIRT073753	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555951	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT555950	hsa-miR-6083	PAR-CLIP	21572407
MIRT073760	hsa-miR-3674	PAR-CLIP	21572407
MIRT1196615	hsa-miR-1226	CLIP-seq
MIRT1196616	hsa-miR-338-3p	CLIP-seq
MIRT1196617	hsa-miR-3663-5p	CLIP-seq
MIRT1196618	hsa-miR-4251	CLIP-seq
MIRT1196619	hsa-miR-4796-3p	CLIP-seq
MIRT1196620	hsa-miR-539	CLIP-seq
MIRT1196621	hsa-miR-634	CLIP-seq
MIRT1196616	hsa-miR-338-3p	CLIP-seq
MIRT1196616	hsa-miR-338-3p	CLIP-seq
MIRT2583541	hsa-miR-133a	CLIP-seq
MIRT2583542	hsa-miR-133b	CLIP-seq
MIRT2583543	hsa-miR-3140-5p	CLIP-seq
MIRT2583544	hsa-miR-543	CLIP-seq
MIRT2583541	hsa-miR-133a	CLIP-seq
MIRT2583542	hsa-miR-133b	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000166	Function	Nucleotide binding	TAS	7926816
GO:0001558	Process	Regulation of cell growth	IMP	18573874
GO:0005515	Function	Protein binding	IPI	18573874, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IDA
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	18573874
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IMP	18573874
GO:0010826	Process	Negative regulation of centrosome duplication	IEA
GO:0016226	Process	Iron-sulfur cluster assembly	IBA
GO:0016226	Process	Iron-sulfur cluster assembly	IEA
GO:0016226	Process	Iron-sulfur cluster assembly	IMP	18573874
GO:0030030	Process	Cell projection organization	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IBA
GO:0051536	Function	Iron-sulfur cluster binding	IDA	18573874
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IEA
GO:0051642	Process	Centrosome localization	IEA
GO:0072697	Process	Protein localization to cell cortex	IEA
GO:0140663	Function	ATP-dependent FeS chaperone activity	IEA

MIM	HGNC	e!Ensembl
600280	8041	ENSG00000103274

P53384

Protein name

Cytosolic Fe-S cluster assembly factor NUBP1 (Nucleotide-binding protein 1) (NBP 1)

Protein function

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery (PubMed:18573874). Required for maturation of extramitochondrial Fe-S proteins (PubMed:18573874). The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10609	ParA	52 → 304	NUBPL iron-transfer P-loop NTPase	Family

Sequence

MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVL
SGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPV
YVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEH
LSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKK
ESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSII
QRIQEFCNLHQSKEENLISS

Sequence length

320

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NUBP1 (NUBP iron-sulfur cluster assembly factor 1, cytosolic)