Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4680
Gene name	CEA cell adhesion molecule 6
Gene symbol	CEACAM6
Synonyms (NCBI Gene)	CD66cCEALNCANCA-50/90
Chromosome	19
Chromosome location	19q13.2
Summary	This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tu

175

Show/Hide all (175)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038060	hsa-miR-423-5p	CLASH	23622248
MIRT438274	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	25171863
MIRT438274	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	25171863
MIRT736081	hsa-miR-765	Microarray	31498480
MIRT736555	hsa-miR-26a-1-3p	Luciferase reporter assayWestern blottingqRT-PCR	32648688
MIRT736593	hsa-miR-146a-3p	Luciferase reporter assayWestern blottingqRT-PCR	32648688
MIRT883038	hsa-miR-1179	CLIP-seq
MIRT883039	hsa-miR-1229	CLIP-seq
MIRT883040	hsa-miR-140-5p	CLIP-seq
MIRT883041	hsa-miR-1914	CLIP-seq
MIRT883042	hsa-miR-1976	CLIP-seq
MIRT883043	hsa-miR-2116	CLIP-seq
MIRT883044	hsa-miR-2278	CLIP-seq
MIRT883045	hsa-miR-29a	CLIP-seq
MIRT883046	hsa-miR-29b	CLIP-seq
MIRT883047	hsa-miR-29c	CLIP-seq
MIRT883048	hsa-miR-3143	CLIP-seq
MIRT883049	hsa-miR-3158-3p	CLIP-seq
MIRT883050	hsa-miR-3198	CLIP-seq
MIRT883051	hsa-miR-338-3p	CLIP-seq
MIRT883052	hsa-miR-3545-5p	CLIP-seq
MIRT883053	hsa-miR-3591-5p	CLIP-seq
MIRT883054	hsa-miR-3611	CLIP-seq
MIRT883055	hsa-miR-3668	CLIP-seq
MIRT883056	hsa-miR-380	CLIP-seq
MIRT883057	hsa-miR-3924	CLIP-seq
MIRT883058	hsa-miR-3925-3p	CLIP-seq
MIRT883059	hsa-miR-4309	CLIP-seq
MIRT883060	hsa-miR-4425	CLIP-seq
MIRT883061	hsa-miR-4433	CLIP-seq
MIRT883062	hsa-miR-4446-3p	CLIP-seq
MIRT883063	hsa-miR-4459	CLIP-seq
MIRT883064	hsa-miR-4460	CLIP-seq
MIRT883065	hsa-miR-4468	CLIP-seq
MIRT883066	hsa-miR-4495	CLIP-seq
MIRT883067	hsa-miR-4509	CLIP-seq
MIRT883068	hsa-miR-450b-3p	CLIP-seq
MIRT883069	hsa-miR-4530	CLIP-seq
MIRT883070	hsa-miR-4677-5p	CLIP-seq
MIRT883071	hsa-miR-4727-3p	CLIP-seq
MIRT883072	hsa-miR-4768-3p	CLIP-seq
MIRT883073	hsa-miR-4778-3p	CLIP-seq
MIRT883074	hsa-miR-543	CLIP-seq
MIRT883075	hsa-miR-548ad	CLIP-seq
MIRT883076	hsa-miR-766	CLIP-seq
MIRT883077	hsa-miR-769-3p	CLIP-seq
MIRT883078	hsa-miR-892b	CLIP-seq
MIRT1961823	hsa-miR-1245b-3p	CLIP-seq
MIRT1961824	hsa-miR-1283	CLIP-seq
MIRT1961825	hsa-miR-1285	CLIP-seq
MIRT1961826	hsa-miR-15a	CLIP-seq
MIRT1961827	hsa-miR-15b	CLIP-seq
MIRT1961828	hsa-miR-16	CLIP-seq
MIRT1961829	hsa-miR-195	CLIP-seq
MIRT1961830	hsa-miR-2052	CLIP-seq
MIRT1961831	hsa-miR-2054	CLIP-seq
MIRT1961832	hsa-miR-2277-3p	CLIP-seq
MIRT883045	hsa-miR-29a	CLIP-seq
MIRT883046	hsa-miR-29b	CLIP-seq
MIRT883047	hsa-miR-29c	CLIP-seq
MIRT1961833	hsa-miR-3065-3p	CLIP-seq
MIRT883048	hsa-miR-3143	CLIP-seq
MIRT1961834	hsa-miR-3153	CLIP-seq
MIRT1961835	hsa-miR-3187-5p	CLIP-seq
MIRT1961836	hsa-miR-331-3p	CLIP-seq
MIRT1961837	hsa-miR-338-5p	CLIP-seq
MIRT1961838	hsa-miR-3659	CLIP-seq
MIRT1961839	hsa-miR-3913-3p	CLIP-seq
MIRT1961840	hsa-miR-3921	CLIP-seq
MIRT1961841	hsa-miR-424	CLIP-seq
MIRT1961842	hsa-miR-4280	CLIP-seq
MIRT1961843	hsa-miR-4292	CLIP-seq
MIRT1961844	hsa-miR-4311	CLIP-seq
MIRT1961845	hsa-miR-4422	CLIP-seq
MIRT1961846	hsa-miR-4480	CLIP-seq
MIRT1961847	hsa-miR-4653-5p	CLIP-seq
MIRT1961848	hsa-miR-4658	CLIP-seq
MIRT1961849	hsa-miR-4666-3p	CLIP-seq
MIRT1961850	hsa-miR-4668-5p	CLIP-seq
MIRT1961851	hsa-miR-4682	CLIP-seq
MIRT1961852	hsa-miR-4714-5p	CLIP-seq
MIRT1961853	hsa-miR-4722-3p	CLIP-seq
MIRT1961854	hsa-miR-4766-5p	CLIP-seq
MIRT1961855	hsa-miR-4768-5p	CLIP-seq
MIRT883073	hsa-miR-4778-3p	CLIP-seq
MIRT1961856	hsa-miR-4786-5p	CLIP-seq
MIRT1961857	hsa-miR-4793-5p	CLIP-seq
MIRT1961858	hsa-miR-489	CLIP-seq
MIRT1961859	hsa-miR-497	CLIP-seq
MIRT1961860	hsa-miR-514	CLIP-seq
MIRT1961861	hsa-miR-514b-3p	CLIP-seq
MIRT883074	hsa-miR-543	CLIP-seq
MIRT1961862	hsa-miR-574-5p	CLIP-seq
MIRT1961863	hsa-miR-612	CLIP-seq
MIRT1961864	hsa-miR-635	CLIP-seq
MIRT1961865	hsa-miR-642b	CLIP-seq
MIRT2198363	hsa-miR-1207-3p	CLIP-seq
MIRT2198364	hsa-miR-1272	CLIP-seq
MIRT2198365	hsa-miR-127-5p	CLIP-seq
MIRT1961824	hsa-miR-1283	CLIP-seq
MIRT1961825	hsa-miR-1285	CLIP-seq
MIRT2198366	hsa-miR-1321	CLIP-seq
MIRT2198367	hsa-miR-1322	CLIP-seq
MIRT1961826	hsa-miR-15a	CLIP-seq
MIRT1961827	hsa-miR-15b	CLIP-seq
MIRT1961828	hsa-miR-16	CLIP-seq
MIRT1961829	hsa-miR-195	CLIP-seq
MIRT883042	hsa-miR-1976	CLIP-seq
MIRT2198368	hsa-miR-205	CLIP-seq
MIRT2198369	hsa-miR-219-1-3p	CLIP-seq
MIRT1961832	hsa-miR-2277-3p	CLIP-seq
MIRT883044	hsa-miR-2278	CLIP-seq
MIRT2198370	hsa-miR-3119	CLIP-seq
MIRT2198371	hsa-miR-3123	CLIP-seq
MIRT883049	hsa-miR-3158-3p	CLIP-seq
MIRT2198372	hsa-miR-3162-5p	CLIP-seq
MIRT2198373	hsa-miR-3163	CLIP-seq
MIRT1961835	hsa-miR-3187-5p	CLIP-seq
MIRT1961836	hsa-miR-331-3p	CLIP-seq
MIRT883051	hsa-miR-338-3p	CLIP-seq
MIRT1961837	hsa-miR-338-5p	CLIP-seq
MIRT2198374	hsa-miR-339-5p	CLIP-seq
MIRT883054	hsa-miR-3611	CLIP-seq
MIRT2198375	hsa-miR-361-5p	CLIP-seq
MIRT2198376	hsa-miR-362-5p	CLIP-seq
MIRT2198377	hsa-miR-3662	CLIP-seq
MIRT2198378	hsa-miR-3664-5p	CLIP-seq
MIRT2198379	hsa-miR-3682-5p	CLIP-seq
MIRT883058	hsa-miR-3925-3p	CLIP-seq
MIRT1961841	hsa-miR-424	CLIP-seq
MIRT2198380	hsa-miR-4260	CLIP-seq
MIRT2198381	hsa-miR-4266	CLIP-seq
MIRT2198382	hsa-miR-4270	CLIP-seq
MIRT2198383	hsa-miR-4283	CLIP-seq
MIRT1961843	hsa-miR-4292	CLIP-seq
MIRT1961844	hsa-miR-4311	CLIP-seq
MIRT1961845	hsa-miR-4422	CLIP-seq
MIRT883060	hsa-miR-4425	CLIP-seq
MIRT883061	hsa-miR-4433	CLIP-seq
MIRT2198384	hsa-miR-4441	CLIP-seq
MIRT883062	hsa-miR-4446-3p	CLIP-seq
MIRT883063	hsa-miR-4459	CLIP-seq
MIRT883065	hsa-miR-4468	CLIP-seq
MIRT2198385	hsa-miR-4473	CLIP-seq
MIRT1961846	hsa-miR-4480	CLIP-seq
MIRT2198386	hsa-miR-4489	CLIP-seq
MIRT883068	hsa-miR-450b-3p	CLIP-seq
MIRT883069	hsa-miR-4530	CLIP-seq
MIRT1961849	hsa-miR-4666-3p	CLIP-seq
MIRT2198387	hsa-miR-4671-3p	CLIP-seq
MIRT2198388	hsa-miR-4695-5p	CLIP-seq
MIRT2198389	hsa-miR-4704-5p	CLIP-seq
MIRT1961852	hsa-miR-4714-5p	CLIP-seq
MIRT1961853	hsa-miR-4722-3p	CLIP-seq
MIRT2198390	hsa-miR-4733-3p	CLIP-seq
MIRT2198391	hsa-miR-4739	CLIP-seq
MIRT2198392	hsa-miR-4756-5p	CLIP-seq
MIRT883072	hsa-miR-4768-3p	CLIP-seq
MIRT2198393	hsa-miR-4773	CLIP-seq
MIRT2198394	hsa-miR-4779	CLIP-seq
MIRT1961856	hsa-miR-4786-5p	CLIP-seq
MIRT1961857	hsa-miR-4793-5p	CLIP-seq
MIRT1961859	hsa-miR-497	CLIP-seq
MIRT2198395	hsa-miR-500b	CLIP-seq
MIRT2198396	hsa-miR-501-5p	CLIP-seq
MIRT2198397	hsa-miR-512-3p	CLIP-seq
MIRT2198398	hsa-miR-520f	CLIP-seq
MIRT2198399	hsa-miR-571	CLIP-seq
MIRT2198400	hsa-miR-578	CLIP-seq
MIRT2198401	hsa-miR-581	CLIP-seq
MIRT2198402	hsa-miR-583	CLIP-seq
MIRT1961863	hsa-miR-612	CLIP-seq
MIRT883076	hsa-miR-766	CLIP-seq
MIRT883077	hsa-miR-769-3p	CLIP-seq
MIRT2198403	hsa-miR-935	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21982860, 26483485, 32296183
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IMP	2803308, 11590190
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	2803308, 8776764, 11590190
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	25171863
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IC	2803308
GO:0009986	Component	Cell surface	IDA	2317824, 8776764, 16204051
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IDA	2317824
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	10436421
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	16204051, 25171863
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IMP	16204051
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0042802	Function	Identical protein binding	IDA	26483485
GO:0042802	Function	Identical protein binding	IPI	21982860, 26483485, 32296183
GO:0046982	Function	Protein heterodimerization activity	IDA	26483485
GO:0098552	Component	Side of membrane	IEA
GO:1904906	Process	Positive regulation of endothelial cell-matrix adhesion via fibronectin	IMP	16204051
GO:2000811	Process	Negative regulation of anoikis	IMP	10910050

MIM	HGNC	e!Ensembl
163980	1818	ENSG00000086548

P40199

Protein name

Cell adhesion molecule CEACAM6 (Carcinoembryonic antigen-related cell adhesion molecule 6) (CEA cell adhesion molecule 6) (Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)

Protein function

Cell surface glycoprotein that plays a role in cell adhesion and tumor progression (PubMed:10910050, PubMed:11590190, PubMed:1378450, PubMed:16204051, PubMed:2022629, PubMed:2803308, PubMed:8776764). Intercellular adhesion occurs in a calcium- a

PDB

4WHC , 4WTZ , 4Y8A , 4YIQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	38 → 141	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	146 → 219		Domain
PF13895	Ig_2	239 → 318	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in neutrophils (PubMed:1378450). Expressed in columnar epithelial and goblet cells of the colon (PubMed:10436421). Expressed in numerous tumor cell lines (at protein level) (PubMed:16204051). {ECO:0000269|PubMed:10436421, ECO

Sequence

MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQ
NRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWV
NGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGP
TISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ
AHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI

Sequence length

344

Interactions

View interactions

	Reactome
			Fibronectin matrix formation Cell surface interactions at the vascular wall Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (108)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17909799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15208677, 17201906, 24326999, 25299082, 2830274, 28475729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15208677, 15316565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17201906, 25171863, 31474761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	14724575, 15047158, 15208677, 15316565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	14512395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28084080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28275137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28275137, 39239252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	10374883, 21365622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28475729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18223215, 18614350, 29110374, 30058236, 31222613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18221536, 18614350, 23592399, 32235022, 33838601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10666389, 15729073, 25299082, 31171910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11896570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	31171910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31474761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24476519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34639156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24231528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16868542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16868542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	26374831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28084080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20381273, 24914378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34394073	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22975528, 23027178, 24914378, 2830274, 3390172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17201906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17201906	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26673628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	10666389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14512395, 22975528, 23027178, 25872647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10666389, 16755296, 26673628, 26993598, 34394073, 37535601, 37816733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	14512395, 28521477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31807423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17525800, 21178454, 21559399, 21688348, 23358328, 24326999, 24914378, 28806140, 31393983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17525800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17525800, 20587550, 21559399, 25706391, 31393983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24326999, 34394073	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20047061		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	36360783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28084080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31498480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25299082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	26993598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	21178454, 21688348, 28806140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23021083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18614350	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	39674878	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22761659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28084080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19637360	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21559399, 28806140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21559399, 34394073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	16868542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28806140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	10980394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20063526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	22037359, 26374831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	22037359, 26374831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20090913, 24625834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26374831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15729073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16868542, 25299082	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23021083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18223215, 18614350, 29110374, 30058236, 31222613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31498480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15383794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31474761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15208677, 23857344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17201906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15132764, 21618249, 24492534, 25299082, 25398131, 25703140, 28883649, 29137373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12115552, 14724575, 15047158, 16868542, 19411761, 23021083, 23027178, 25703140, 29110374, 29687339, 29881289, 31133507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22975528, 23027178, 24914378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18223215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23603913, 30809317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23603913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11896570, 15297395, 15383794, 16632476, 17201906, 18614350, 21741385, 22975528, 23021083, 23027178, 24492534, 25299082, 25398131, 28604612, 28883649 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29881289		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17503391, 18331757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35302657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15208677, 23857344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31171910, 31797958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	17201906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15729073, 19411761, 34321959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	24476519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	25475535		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	39239252	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31797958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	28084080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	20666852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	15826304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	21470677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17201906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17201906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	39239252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26374831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28892050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23021083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stickler syndrome, type 1	Stickler syndrome	BEFREE	16632476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15132764, 24492534, 25299082, 25398131, 25703140, 28883649, 29137373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	25299082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25299082, 28883649, 32816956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39674878	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21559399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	15729073, 31171910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39346086	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CEACAM6 (CEA cell adhesion molecule 6)