Gene Gene information from NCBI Gene database.
Entrez ID 467
Gene name Activating transcription factor 3
Gene symbol ATF3
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1q32.3
Summary This gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells,
miRNA miRNA information provided by mirtarbase database.
94
miRTarBase ID miRNA Experiments Reference
MIRT029081 hsa-miR-26b-5p Microarray 19088304
MIRT050819 hsa-miR-17-5p CLASH 23622248
MIRT043494 hsa-miR-331-3p CLASH 23622248
MIRT053227 hsa-miR-494-3p qRT-PCRWestern blot 23160513
MIRT438586 hsa-miR-30a-3p ImmunohistochemistryMicroarrayqRT-PCR 23787480
Transcription factors Transcription factors information provided by TRRUST V2 database.
14
Transcription factor Regulation Reference
ATF2 Activation 10979959;20581861;8576171
ATF4 Activation 16246168;21801305
ATF4 Unknown 22819556
EGR1 Activation 21205742
EGR1 Unknown 16489044
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
57
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 7515060, 8622660
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 14685163
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 24939851
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603148 785 ENSG00000162772
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P18847
Protein name Cyclic AMP-dependent transcription factor ATF-3 (cAMP-dependent transcription factor ATF-3) (Activating transcription factor 3)
Protein function This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing th
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 84 145 bZIP transcription factor Coiled-coil
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYM
LNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S
Sequence length 181
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Response of EIF2AK1 (HRI) to heme deficiency
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
20
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ARTHRITIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATF3-related disorder Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adrenocortical carcinoma Adrenocortical carcinoma BEFREE 25400120
★☆☆☆☆
Found in Text Mining only
Adrenocortical Carcinoma Adrenocortical carcinoma Pubtator 25400120, 39965324 Associate
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 21414204
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 31377428 Associate
★☆☆☆☆
Found in Text Mining only
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 29242405
★☆☆☆☆
Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 28701342, 30302023
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 31332965
★☆☆☆☆
Found in Text Mining only
Arthropathy Arthropathy BEFREE 27159257
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 18794337
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 30669148 Associate
★☆☆☆☆
Found in Text Mining only