Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4665
Gene name	NGFI-A binding protein 2
Gene symbol	NAB2
Synonyms (NCBI Gene)	MADER
Chromosome	12
Chromosome location	12q13.3
Summary	This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multim

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018637	hsa-miR-335-5p	Microarray	18185580
MIRT1172507	hsa-miR-1207-5p	CLIP-seq
MIRT1172508	hsa-miR-1275	CLIP-seq
MIRT1172509	hsa-miR-1280	CLIP-seq
MIRT1172510	hsa-miR-188-3p	CLIP-seq
MIRT1172511	hsa-miR-3179	CLIP-seq
MIRT1172512	hsa-miR-3668	CLIP-seq
MIRT1172513	hsa-miR-4436b-3p	CLIP-seq
MIRT1172514	hsa-miR-4640-5p	CLIP-seq
MIRT1172515	hsa-miR-4650-5p	CLIP-seq
MIRT1172516	hsa-miR-4665-5p	CLIP-seq
MIRT1172517	hsa-miR-4713-3p	CLIP-seq
MIRT1172518	hsa-miR-4726-5p	CLIP-seq
MIRT1172519	hsa-miR-4740-3p	CLIP-seq
MIRT1172520	hsa-miR-4761-3p	CLIP-seq
MIRT1172521	hsa-miR-4763-3p	CLIP-seq
MIRT1172522	hsa-miR-495	CLIP-seq
MIRT1172523	hsa-miR-518a-5p	CLIP-seq
MIRT1172524	hsa-miR-527	CLIP-seq
MIRT2049852	hsa-miR-134	CLIP-seq
MIRT2049853	hsa-miR-1915	CLIP-seq
MIRT2049854	hsa-miR-2467-3p	CLIP-seq
MIRT2049855	hsa-miR-28-3p	CLIP-seq
MIRT2049856	hsa-miR-296-3p	CLIP-seq
MIRT2049857	hsa-miR-3064-3p	CLIP-seq
MIRT2049858	hsa-miR-3118	CLIP-seq
MIRT2049859	hsa-miR-3125	CLIP-seq
MIRT2049860	hsa-miR-3164	CLIP-seq
MIRT2049861	hsa-miR-3916	CLIP-seq
MIRT2049862	hsa-miR-409-3p	CLIP-seq
MIRT2049863	hsa-miR-4252	CLIP-seq
MIRT2049864	hsa-miR-4423-5p	CLIP-seq
MIRT1172513	hsa-miR-4436b-3p	CLIP-seq
MIRT2049865	hsa-miR-4476	CLIP-seq
MIRT2049866	hsa-miR-4535	CLIP-seq
MIRT2049867	hsa-miR-4661-3p	CLIP-seq
MIRT2049868	hsa-miR-4685-5p	CLIP-seq
MIRT2049869	hsa-miR-4715-3p	CLIP-seq
MIRT2049870	hsa-miR-492	CLIP-seq
MIRT2049871	hsa-miR-758	CLIP-seq
MIRT2049872	hsa-miR-767-3p	CLIP-seq
MIRT2049852	hsa-miR-134	CLIP-seq
MIRT2049854	hsa-miR-2467-3p	CLIP-seq
MIRT2049856	hsa-miR-296-3p	CLIP-seq
MIRT2049858	hsa-miR-3118	CLIP-seq
MIRT2049859	hsa-miR-3125	CLIP-seq
MIRT2049860	hsa-miR-3164	CLIP-seq
MIRT2049861	hsa-miR-3916	CLIP-seq
MIRT2049865	hsa-miR-4476	CLIP-seq
MIRT2049867	hsa-miR-4661-3p	CLIP-seq
MIRT2049868	hsa-miR-4685-5p	CLIP-seq
MIRT2049871	hsa-miR-758	CLIP-seq
MIRT1172515	hsa-miR-4650-5p	CLIP-seq
MIRT1172519	hsa-miR-4740-3p	CLIP-seq
MIRT2577121	hsa-miR-122	CLIP-seq
MIRT2577122	hsa-miR-1228	CLIP-seq
MIRT2577123	hsa-miR-1276	CLIP-seq
MIRT2577124	hsa-miR-1294	CLIP-seq
MIRT2577125	hsa-miR-1321	CLIP-seq
MIRT2577126	hsa-miR-146b-3p	CLIP-seq
MIRT2577127	hsa-miR-147	CLIP-seq
MIRT2577128	hsa-miR-1827	CLIP-seq
MIRT2577129	hsa-miR-19a	CLIP-seq
MIRT2577130	hsa-miR-19b	CLIP-seq
MIRT2577131	hsa-miR-3123	CLIP-seq
MIRT2577132	hsa-miR-3126-5p	CLIP-seq
MIRT2577133	hsa-miR-3173-5p	CLIP-seq
MIRT2577134	hsa-miR-3612	CLIP-seq
MIRT2577135	hsa-miR-4254	CLIP-seq
MIRT2577136	hsa-miR-4308	CLIP-seq
MIRT2577137	hsa-miR-4311	CLIP-seq
MIRT2577138	hsa-miR-4313	CLIP-seq
MIRT2577139	hsa-miR-4316	CLIP-seq
MIRT2577140	hsa-miR-4419a	CLIP-seq
MIRT2577141	hsa-miR-4443	CLIP-seq
MIRT2577142	hsa-miR-4510	CLIP-seq
MIRT2577143	hsa-miR-4668-5p	CLIP-seq
MIRT2577144	hsa-miR-4728-5p	CLIP-seq
MIRT2577145	hsa-miR-4739	CLIP-seq
MIRT2577146	hsa-miR-4744	CLIP-seq
MIRT2577147	hsa-miR-4756-5p	CLIP-seq
MIRT2577148	hsa-miR-502-5p	CLIP-seq
MIRT2577149	hsa-miR-548q	CLIP-seq
MIRT2577150	hsa-miR-574-5p	CLIP-seq
MIRT2577151	hsa-miR-583	CLIP-seq
MIRT2577152	hsa-miR-650	CLIP-seq
MIRT2577153	hsa-miR-874	CLIP-seq
MIRT2577121	hsa-miR-122	CLIP-seq
MIRT2577122	hsa-miR-1228	CLIP-seq
MIRT2577123	hsa-miR-1276	CLIP-seq
MIRT2577124	hsa-miR-1294	CLIP-seq
MIRT2577125	hsa-miR-1321	CLIP-seq
MIRT2577126	hsa-miR-146b-3p	CLIP-seq
MIRT2577127	hsa-miR-147	CLIP-seq
MIRT2577128	hsa-miR-1827	CLIP-seq
MIRT2577129	hsa-miR-19a	CLIP-seq
MIRT2577130	hsa-miR-19b	CLIP-seq
MIRT2577131	hsa-miR-3123	CLIP-seq
MIRT2577132	hsa-miR-3126-5p	CLIP-seq
MIRT2577133	hsa-miR-3173-5p	CLIP-seq
MIRT2577134	hsa-miR-3612	CLIP-seq
MIRT2577135	hsa-miR-4254	CLIP-seq
MIRT2577136	hsa-miR-4308	CLIP-seq
MIRT2577137	hsa-miR-4311	CLIP-seq
MIRT2577139	hsa-miR-4316	CLIP-seq
MIRT2577140	hsa-miR-4419a	CLIP-seq
MIRT2577141	hsa-miR-4443	CLIP-seq
MIRT2577142	hsa-miR-4510	CLIP-seq
MIRT2577143	hsa-miR-4668-5p	CLIP-seq
MIRT2577144	hsa-miR-4728-5p	CLIP-seq
MIRT2577145	hsa-miR-4739	CLIP-seq
MIRT2577146	hsa-miR-4744	CLIP-seq
MIRT2577147	hsa-miR-4756-5p	CLIP-seq
MIRT2577149	hsa-miR-548q	CLIP-seq
MIRT2577150	hsa-miR-574-5p	CLIP-seq
MIRT2577151	hsa-miR-583	CLIP-seq
MIRT2577152	hsa-miR-650	CLIP-seq
MIRT2577153	hsa-miR-874	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
EGR1	Activation	16260776;20506119
EGR3	Activation	20506119

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001958	Process	Endochondral ossification	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003714	Function	Transcription corepressor activity	TAS	8668170
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0014037	Process	Schwann cell differentiation	IEA
GO:0016480	Process	Negative regulation of transcription by RNA polymerase III	IDA	8668170
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0045682	Process	Regulation of epidermis development	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA

MIM	HGNC	e!Ensembl
602381	7627	ENSG00000166886

Q15742

Protein name

NGFI-A-binding protein 2 (EGR-1-binding protein 2) (Melanoma-associated delayed early response protein) (Protein MADER)

Protein function

Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04904	NCD1	36 → 114	NAB conserved region 1 (NCD1)	Domain
PF04905	NCD2	236 → 364	NAB conserved region 2 (NCD2)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at low levels. Highly expressed in melanoma cell lines.

Sequence

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYET
FIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAV
PVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAG
DPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPE
MVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI
IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSL
KGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSP
CVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ

Sequence length

525

Interactions

View interactions

	Reactome
			NGF-stimulated transcription EGR2 and SOX10-mediated initiation of Schwann cell myelination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (56)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar disorder	Pubtator	20633309	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22431919, 25104439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	15241441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	8391183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	33563892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20489156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	20392463	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypomyelinating neuropathy	Congenital Hypomyelinating Neuropathy	BEFREE	16136673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	30819530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29307595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29307595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	33563892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26817999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26817999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26817999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35303277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	ORPHANET_DG	23313952, 23313954		★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	24513261, 25893823, 26746203, 27271270, 28128724, 28295484, 29600523, 30233017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	23575898, 25893823, 27271270, 28295484, 29600523, 30233017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	30819530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	30819530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30578643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	8668170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	24702701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	23860521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20489156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11567222, 16956712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26253700, 29464024, 30845713, 30893927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	9730695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23860521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasia of the pleura	Neoplasia of the pleura	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11567222, 20489156, 23313952, 24513261, 26022454, 26883114, 27292373, 28443588, 30233017, 30584643, 30819530, 30893927, 31321477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17207284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	12030330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11567222, 16956712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11567222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35238118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17207284	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	20633309	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Soft Tissue Neoplasms	Soft Tissue Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	23313952, 23313954, 23575898, 23761323, 24434011, 24457460, 24513261, 24702701, 24807787, 25482924, 25554652, 25582503, 25667482, 25893823, 26022454 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	ORPHANET_DG	23313952, 23313954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	CTD_human_DG	23313952, 23313954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17290407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30845713, 30893927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urogenital Neoplasms	Urogenital neoplasm	Pubtator	27802414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

NAB2 (NGFI-A binding protein 2)