MYT1 (myelin transcription factor 1)

Gene

• Entrez ID: 4661
• Gene name: Myelin transcription factor 1
• Gene symbol: MYT1
• Synonyms (NCBI Gene): C20orf36, MTF1, MYTI, NZF2, PLPB1, ZC2H2C1, ZC2HC4A
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing ne

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001770	hsa-miR-27a-3p	Western blot	18006846
MIRT001770	hsa-miR-27a-3p	Luciferase reporter assay	18006846
MIRT001770	hsa-miR-27a-3p	Other	18006846
MIRT1170656	hsa-miR-1208	CLIP-seq
MIRT1170657	hsa-miR-1273g	CLIP-seq
MIRT1170658	hsa-miR-136	CLIP-seq
MIRT1170659	hsa-miR-150	CLIP-seq
MIRT1170660	hsa-miR-1915	CLIP-seq
MIRT1170661	hsa-miR-200b	CLIP-seq
MIRT1170662	hsa-miR-200c	CLIP-seq
MIRT1170663	hsa-miR-2054	CLIP-seq
MIRT1170664	hsa-miR-219-1-3p	CLIP-seq
MIRT1170665	hsa-miR-224	CLIP-seq
MIRT1170666	hsa-miR-3147	CLIP-seq
MIRT1170667	hsa-miR-34b	CLIP-seq
MIRT1170668	hsa-miR-3684	CLIP-seq
MIRT1170669	hsa-miR-3929	CLIP-seq
MIRT1170670	hsa-miR-4259	CLIP-seq
MIRT1170671	hsa-miR-429	CLIP-seq
MIRT1170672	hsa-miR-4294	CLIP-seq
MIRT1170673	hsa-miR-4318	CLIP-seq
MIRT1170674	hsa-miR-4419b	CLIP-seq
MIRT1170675	hsa-miR-4433	CLIP-seq
MIRT1170676	hsa-miR-4459	CLIP-seq
MIRT1170677	hsa-miR-4478	CLIP-seq
MIRT1170678	hsa-miR-4677-3p	CLIP-seq
MIRT1170679	hsa-miR-4681	CLIP-seq
MIRT1170680	hsa-miR-4684-3p	CLIP-seq
MIRT1170681	hsa-miR-4693-5p	CLIP-seq
MIRT1170682	hsa-miR-4698	CLIP-seq
MIRT1170683	hsa-miR-4713-5p	CLIP-seq
MIRT1170684	hsa-miR-4726-3p	CLIP-seq
MIRT1170685	hsa-miR-4768-3p	CLIP-seq
MIRT1170686	hsa-miR-4768-5p	CLIP-seq
MIRT1170687	hsa-miR-511	CLIP-seq
MIRT1170688	hsa-miR-518a-5p	CLIP-seq
MIRT1170689	hsa-miR-527	CLIP-seq
MIRT1170690	hsa-miR-532-3p	CLIP-seq
MIRT1170691	hsa-miR-571	CLIP-seq
MIRT1170692	hsa-miR-885-5p	CLIP-seq
MIRT1170693	hsa-miR-892a	CLIP-seq
MIRT2278264	hsa-miR-128	CLIP-seq
MIRT2278265	hsa-miR-1302	CLIP-seq
MIRT2278266	hsa-miR-144	CLIP-seq
MIRT2278267	hsa-miR-1587	CLIP-seq
MIRT2278268	hsa-miR-27a	CLIP-seq
MIRT2278269	hsa-miR-27b	CLIP-seq
MIRT2278270	hsa-miR-4298	CLIP-seq
MIRT2278271	hsa-miR-4417	CLIP-seq
MIRT2278272	hsa-miR-4446-5p	CLIP-seq
MIRT2278273	hsa-miR-4492	CLIP-seq
MIRT2278274	hsa-miR-4498	CLIP-seq
MIRT2278275	hsa-miR-4505	CLIP-seq
MIRT2278276	hsa-miR-4656	CLIP-seq
MIRT2278277	hsa-miR-4675	CLIP-seq
MIRT2278278	hsa-miR-4741	CLIP-seq
MIRT2278279	hsa-miR-4755-5p	CLIP-seq
MIRT2278280	hsa-miR-4773	CLIP-seq
MIRT2278281	hsa-miR-490-5p	CLIP-seq
MIRT2278282	hsa-miR-541	CLIP-seq
MIRT2278283	hsa-miR-642a	CLIP-seq
MIRT2278284	hsa-miR-654-5p	CLIP-seq
MIRT2278285	hsa-miR-759	CLIP-seq
MIRT2278286	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	1280325
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	1280325
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	1280325
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	1280325
GO:0030154	Process	Cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 600379
• HGNC: 7622
• e!Ensembl: ENSG00000196132

Protein

• UniProt ID: Q01538
• Protein name: Myelin transcription factor 1 (MyT1) (Myelin transcription factor I) (MyTI) (PLPB1) (Proteolipid protein-binding protein)
• Protein function: Binds to the promoter region of genes encoding proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendroglia in the CNS. May regulate a critical transition point in oligodendrocyte lineage
• PDB: 7Q45
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01530	zf-C2HC	29 → 57	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	441 → 468	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	485 → 513	Zinc finger, C2HC type	Family
  PF08474	MYT1	560 → 617	Myelin transcription factor 1	Family
  PF08474	MYT1	615 → 791	Myelin transcription factor 1	Family
  PF01530	zf-C2HC	799 → 827	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	843 → 871	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	892 → 920	Zinc finger, C2HC type	Family
  PF01530	zf-C2HC	945 → 973	Zinc finger, C2HC type	Family

• Tissue specificity: TISSUE SPECIFICITY: Mostly in developing nervous system. Expressed in neural progenitors and oligodendrocyte lineage cells. More highly expressed in oligodendrocyte progenitors than in differentiated oligodendrocytes. {ECO:0000269|PubMed:8530187}.
• Sequence:

  MSLENEDKRARTRSKALRGPPETTAADLSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKKR
  KLEGAEAEHLVSKRKSHPLKLALDEGYGVDSDGSEDTEVKDASVSDESEGTLEGAEAETS
  GQDEIHRPETAEGRSPVKSHFGSNPIGSATASSKGSYSSYQGIIATSLLNLGQIAEETLV
  EEDLGQAAKPGPGIVHLLQEAAEGAASEEGEKGLFIQPEDAEEVVEVTTERSQDLCPQSL
  EDAASEESSKQKGILSHEEEDEEEEEEEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEEEE
  EEEEEEAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRK
  STVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPL
  DTVRKSYYSKDPSRAEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMH
  ENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLAKSHEKQQPQTGDPSKSSSNSD
  RILRPMCFVKQLEVPPYGSYRPNVAPATPRANLAKELEKFSKVTFDYASFDAQVFGKRML
  APKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVD
  IEVDENGTLDLSMHKHRKRENAFPSSSSCSSSPGVKSPDASQRHSSTSAPSSSMTSPQSS
  QASRQDEWDRPLDYTKPSRLREEEPEESEPAAHSFASSEADDQEVSEENFEERKYPGEVT
  LTNFKLKFLSKDIKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSA
  DLKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGVKVAPTKDDKEDPELMKCPVPGCVG
  LGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGS
  FLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSE
  MEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHME
  PICEQNFDAYVSTLTDMYSNQDPENKDLLESIKQAVRGIQV

• Sequence length: 1121

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Intellectual disability	Likely pathogenic	rs1983540456	RCV001261388	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL MICROSOMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOLDENHAR SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary spastic paraplegia	Affects	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYT1-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODIC LIMB MOVEMENT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER-BIPOLAR TYPE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autistic Disorder	Autism	CTD_human_DG	15446388		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20087061	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27847402, 36312586	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20087061		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27847402	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37124062	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	37983626	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24529376, 28224461		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37904700	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	25132343		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37866660	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	20087061		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30087448		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	30087448	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	18341605		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33628376	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	33628376	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17363595, 29707960		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	37128643	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23947958	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29108454	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23947958		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	38018590	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25672434		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37232895	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30588241		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38186569	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19286843		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37215133	Associate	★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	18990686	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37128643	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40255693	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24390342, 30423114		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	24390342		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	26498180		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37095424	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37505170	Stimulate	★☆☆☆☆ Found in Text Mining only