MYO9B (myosin IXB)

Gene

• Entrez ID: 4650
• Gene name: Myosin IXB
• Gene symbol: MYO9B
• Synonyms (NCBI Gene): CELIAC4, MYR5
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: This gene encodes a member of the myosin family of actin-based molecular motor heavy chain proteins. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-9 (MYH9). The protein has four IQ motif

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2305764	G>A,C	Risk-factor	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019067	hsa-miR-335-5p	Microarray	18185580
MIRT051699	hsa-let-7e-5p	CLASH	23622248
MIRT048837	hsa-miR-93-5p	CLASH	23622248
MIRT042019	hsa-miR-484	CLASH	23622248
MIRT715483	hsa-miR-193a-5p	HITS-CLIP	19536157
MIRT715482	hsa-miR-4714-5p	HITS-CLIP	19536157
MIRT715481	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715480	hsa-miR-412-3p	HITS-CLIP	19536157
MIRT715479	hsa-miR-6754-3p	HITS-CLIP	19536157
MIRT715478	hsa-miR-6837-3p	HITS-CLIP	19536157
MIRT715477	hsa-miR-615-5p	HITS-CLIP	19536157
MIRT715476	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT440161	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT440161	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT715483	hsa-miR-193a-5p	HITS-CLIP	19536157
MIRT715482	hsa-miR-4714-5p	HITS-CLIP	19536157
MIRT715481	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715480	hsa-miR-412-3p	HITS-CLIP	19536157
MIRT715479	hsa-miR-6754-3p	HITS-CLIP	19536157
MIRT715478	hsa-miR-6837-3p	HITS-CLIP	19536157
MIRT715477	hsa-miR-615-5p	HITS-CLIP	19536157
MIRT715476	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT1170165	hsa-miR-1237	CLIP-seq
MIRT1170166	hsa-miR-1248	CLIP-seq
MIRT1170167	hsa-miR-1270	CLIP-seq
MIRT1170168	hsa-miR-3616-3p	CLIP-seq
MIRT1170169	hsa-miR-3665	CLIP-seq
MIRT1170170	hsa-miR-3907	CLIP-seq
MIRT1170171	hsa-miR-3921	CLIP-seq
MIRT1170172	hsa-miR-4649-3p	CLIP-seq
MIRT1170173	hsa-miR-4653-5p	CLIP-seq
MIRT1170174	hsa-miR-4683	CLIP-seq
MIRT1170175	hsa-miR-4704-5p	CLIP-seq
MIRT1170176	hsa-miR-4721	CLIP-seq
MIRT1170177	hsa-miR-576-3p	CLIP-seq
MIRT1170178	hsa-miR-620	CLIP-seq
MIRT1170179	hsa-miR-942	CLIP-seq
MIRT1551556	hsa-miR-133a	CLIP-seq
MIRT1551557	hsa-miR-133b	CLIP-seq
MIRT1551558	hsa-miR-885-5p	CLIP-seq
MIRT2049044	hsa-miR-4687-3p	CLIP-seq
MIRT2049045	hsa-miR-561	CLIP-seq
MIRT2049046	hsa-miR-582-5p	CLIP-seq
MIRT1551558	hsa-miR-885-5p	CLIP-seq
MIRT2278125	hsa-miR-1224-3p	CLIP-seq
MIRT2278126	hsa-miR-1321	CLIP-seq
MIRT2278127	hsa-miR-149	CLIP-seq
MIRT2278128	hsa-miR-3130-3p	CLIP-seq
MIRT2278129	hsa-miR-3162-5p	CLIP-seq
MIRT2278130	hsa-miR-345	CLIP-seq
MIRT2278131	hsa-miR-3614-5p	CLIP-seq
MIRT2278132	hsa-miR-3651	CLIP-seq
MIRT2278133	hsa-miR-4260	CLIP-seq
MIRT2278134	hsa-miR-4325	CLIP-seq
MIRT2278135	hsa-miR-4522	CLIP-seq
MIRT2278136	hsa-miR-4739	CLIP-seq
MIRT2278137	hsa-miR-4756-5p	CLIP-seq
MIRT2278138	hsa-miR-4793-3p	CLIP-seq
MIRT2278139	hsa-miR-617	CLIP-seq
MIRT2278140	hsa-miR-766	CLIP-seq
MIRT2442388	hsa-miR-3163	CLIP-seq
MIRT2442389	hsa-miR-4643	CLIP-seq
MIRT2442390	hsa-miR-466	CLIP-seq
MIRT2442391	hsa-miR-4789-3p	CLIP-seq
MIRT2442392	hsa-miR-548aa	CLIP-seq
MIRT2442393	hsa-miR-548ac	CLIP-seq
MIRT2442394	hsa-miR-548d-3p	CLIP-seq
MIRT2442395	hsa-miR-548z	CLIP-seq
MIRT2685687	hsa-miR-1294	CLIP-seq
MIRT2685688	hsa-miR-1297	CLIP-seq
MIRT2685689	hsa-miR-181a	CLIP-seq
MIRT2685690	hsa-miR-181b	CLIP-seq
MIRT2685691	hsa-miR-181c	CLIP-seq
MIRT2685692	hsa-miR-181d	CLIP-seq
MIRT2685693	hsa-miR-26a	CLIP-seq
MIRT2685694	hsa-miR-26b	CLIP-seq
MIRT2278130	hsa-miR-345	CLIP-seq
MIRT2685695	hsa-miR-4262	CLIP-seq
MIRT2685696	hsa-miR-4287	CLIP-seq
MIRT2685697	hsa-miR-4292	CLIP-seq
MIRT2685698	hsa-miR-4308	CLIP-seq
MIRT2685699	hsa-miR-4465	CLIP-seq
MIRT2685700	hsa-miR-4469	CLIP-seq
MIRT2685701	hsa-miR-4685-3p	CLIP-seq
MIRT2685702	hsa-miR-4732-3p	CLIP-seq
MIRT2685703	hsa-miR-4749-3p	CLIP-seq
MIRT2685704	hsa-miR-564	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000146	Function	Microfilament motor activity	IBA
GO:0000146	Function	Microfilament motor activity	IDA	9490638, 11901422, 16338935, 16616011
GO:0000146	Function	Microfilament motor activity	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001726	Component	Ruffle	IBA
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003779	Function	Actin binding	IDA	9490638, 16338935, 16616011
GO:0003779	Function	Actin binding	IEA
GO:0005096	Function	GTPase activator activity	IDA	9490638, 15644318, 26529257
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	15644318, 16417406
GO:0005516	Function	Calmodulin binding	IDA	9490638, 16338935
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IDA	16338935
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	8907710
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IBA
GO:0005884	Component	Actin filament	IDA	8907710, 16338935, 16616011
GO:0005938	Component	Cell cortex	IDA	8907710
GO:0005938	Component	Cell cortex	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IC	9490638
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	8907710
GO:0016020	Component	Membrane	HDA	19946888
GO:0016459	Component	Myosin complex	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0030027	Component	Lamellipodium	IBA
GO:0030048	Process	Actin filament-based movement	IBA
GO:0030048	Process	Actin filament-based movement	IDA	9490638, 11901422, 16338935
GO:0030048	Process	Actin filament-based movement	IEA
GO:0030048	Process	Actin filament-based movement	TAS	8907710
GO:0031267	Function	Small GTPase binding	IPI	26529257
GO:0032011	Process	ARF protein signal transduction	IDA	15644318
GO:0035023	Process	Regulation of Rho protein signal transduction	IMP	26529257
GO:0035385	Process	Roundabout signaling pathway	IDA	26529257
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	11901422
GO:0043531	Function	ADP binding	IDA	16338935
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	8907710
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048495	Function	Roundabout binding	IPI	26529257
GO:0051015	Function	Actin filament binding	IBA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0072673	Process	Lamellipodium morphogenesis	IBA
GO:0098871	Component	Postsynaptic actin cytoskeleton	IDA	30123108
GO:0098871	Component	Postsynaptic actin cytoskeleton	IMP	30123108

Other IDs

• MIM: 602129
• HGNC: 7609
• e!Ensembl: ENSG00000099331

Protein

• UniProt ID: Q13459
• Protein name: Unconventional myosin-IXb (Unconventional myosin-9b)
• Protein function: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calciu
• PDB: 5C5S, 5HPY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00788	RA	15 → 114	Ras association (RalGDS/AF-6) domain	Domain
  PF00063	Myosin_head	148 → 715	Myosin head (motor domain)	Domain
  PF00063	Myosin_head	780 → 941	Myosin head (motor domain)	Domain
  PF00612	IQ	957 → 977	IQ calmodulin-binding motif	Motif
  PF00612	IQ	980 → 1000	IQ calmodulin-binding motif	Motif
  PF00612	IQ	1002 → 1022	IQ calmodulin-binding motif	Motif
  PF00612	IQ	1025 → 1045	IQ calmodulin-binding motif	Motif
  PF00620	RhoGAP	1713 → 1863	RhoGAP domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in peripheral blood leukocytes (at protein level) (PubMed:9490638). Expressed predominantly in peripheral blood leukocytes and at lower levels, in thymus, spleen, testis, prostate, ovary, brain, small intestine and lung. {ECO:
• Sequence:

  MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGT
  KCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
  VHMQLVAQATATRRLVERGLLPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAG
  SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGE
  SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
  QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
  YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA
  TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDS
  MAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
  NEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
  HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
  ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGMSSPGA
  QSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKS
  KGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
  ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
  QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKI
  LLLQSWFRMVLERRHFLQMKRAAVTIQACWRSYRVRRALERTQAAVYLQASWRGYWQRKL
  YRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEEKEREALEAARAGAEEGGQGQAAGG
  QQVAEQGPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEK
  VPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
  ETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLERPTSLALDSRV
  SPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVA
  AASPSAMLSQSLDLSDRHRATGAALTPTEERRTSFSTSDVSKLLPSLAKAQPAAETTDGE
  RSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENA
  VSGHVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
  VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHV
  GYKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKK
  RKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSH
  CSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAA
  NRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
  QEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDN
  SDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPL
  KLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDI
  TYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPGAPTPSPLPTV
  AAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP
  ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG

• Sequence length: 2157

Pathways

KEGG:

Motor proteins

Reactome:

Rho GTPase cycle
Regulation of actin dynamics for phagocytic cup formation
SLIT2:ROBO1 increases RHOA activity
FCGR3A-mediated phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac disease, susceptibility to, 4	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GASTRIC ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Germ cell tumor of testis	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYO9B-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	24386489		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	22954106		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28115390		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17584584, 17948900, 18361936, 19142207, 28627089		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	17948900		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19142207	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22954106		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	26529257		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16282976, 16423886, 16720215, 16835590, 16943798, 16948647, 17087940, 17176439, 17267307, 17438672, 17584584, 17667713, 17767555, 17948900, 17967566, 18077767, 20096742, 20303373, 21688385, 22954106, 23368647, 27219348, 28627089		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	16282976, 16720215, 16943798, 17176439, 17584584, 17667713		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GENOMICS_ENGLAND_DG	21143118		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	23368647, 24386489	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26972322		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24386489	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	17087940, 17944996, 19235913, 21515326, 24966617, 25098938, 27435931		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17087940		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24966617	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18361936, 20303373		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	20096742		★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	17967566		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22954106		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	22954106		★☆☆☆☆ Found in Text Mining only
Gluten intolerance	Gluten intolerance	BEFREE	18077767		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	30487518		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16835590, 16948647, 17087940, 17667713, 17944996, 18077767, 19235913, 20303373, 21515326, 22573889, 24966617, 25098938, 26972322, 27556856		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17087940		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22573889, 24386489, 24966617	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26529257		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17584584		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17584584		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	20852631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26529257		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26529257		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19142207		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	24386489	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	22954106		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26670045	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17584584, 18077767		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17584584		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17948900, 21688385, 25710847		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17948900		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17948900, 21688385, 25710847		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	26811494	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28627089		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	28627089		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17087940, 17944996, 18361936, 19235913, 21515326, 21648020, 22954106, 27435931		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17087940		★☆☆☆☆ Found in Text Mining only