GADD45B (growth arrest and DNA damage inducible beta)

Gene

• Entrez ID: 4616
• Gene name: Growth arrest and DNA damage inducible beta
• Gene symbol: GADD45B
• Synonyms (NCBI Gene): GADD45BETA, MYD118
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1010219	hsa-miR-127-3p	CLIP-seq
MIRT1010220	hsa-miR-130a	CLIP-seq
MIRT1010221	hsa-miR-130b	CLIP-seq
MIRT1010222	hsa-miR-136	CLIP-seq
MIRT1010223	hsa-miR-140-5p	CLIP-seq
MIRT1010224	hsa-miR-219-5p	CLIP-seq
MIRT1010225	hsa-miR-301a	CLIP-seq
MIRT1010226	hsa-miR-301b	CLIP-seq
MIRT1010227	hsa-miR-3121-3p	CLIP-seq
MIRT1010228	hsa-miR-3166	CLIP-seq
MIRT1010229	hsa-miR-3666	CLIP-seq
MIRT1010230	hsa-miR-3925-3p	CLIP-seq
MIRT1010231	hsa-miR-4258	CLIP-seq
MIRT1010232	hsa-miR-4267	CLIP-seq
MIRT1010233	hsa-miR-4295	CLIP-seq
MIRT1010234	hsa-miR-454	CLIP-seq
MIRT1010235	hsa-miR-4771	CLIP-seq
MIRT1010236	hsa-miR-4782-3p	CLIP-seq
MIRT1010237	hsa-miR-495	CLIP-seq
MIRT1010238	hsa-miR-513c	CLIP-seq
MIRT1010239	hsa-miR-514b-5p	CLIP-seq
MIRT1010240	hsa-miR-515-5p	CLIP-seq
MIRT1010241	hsa-miR-519a	CLIP-seq
MIRT1010242	hsa-miR-519b-3p	CLIP-seq
MIRT1010243	hsa-miR-519c-3p	CLIP-seq
MIRT1010244	hsa-miR-767-3p	CLIP-seq
MIRT1010245	hsa-miR-802	CLIP-seq
MIRT1999207	hsa-miR-3940-5p	CLIP-seq
MIRT1010231	hsa-miR-4258	CLIP-seq
MIRT1999208	hsa-miR-4507	CLIP-seq
MIRT1010244	hsa-miR-767-3p	CLIP-seq
MIRT1999209	hsa-miR-891b	CLIP-seq
MIRT2232897	hsa-miR-1225-5p	CLIP-seq
MIRT1010220	hsa-miR-130a	CLIP-seq
MIRT1010221	hsa-miR-130b	CLIP-seq
MIRT1010223	hsa-miR-140-5p	CLIP-seq
MIRT2232898	hsa-miR-150	CLIP-seq
MIRT1010225	hsa-miR-301a	CLIP-seq
MIRT1010226	hsa-miR-301b	CLIP-seq
MIRT2232899	hsa-miR-3157-5p	CLIP-seq
MIRT1010229	hsa-miR-3666	CLIP-seq
MIRT2232900	hsa-miR-3691-3p	CLIP-seq
MIRT1010231	hsa-miR-4258	CLIP-seq
MIRT2232901	hsa-miR-4264	CLIP-seq
MIRT1010232	hsa-miR-4267	CLIP-seq
MIRT1010233	hsa-miR-4295	CLIP-seq
MIRT2232902	hsa-miR-4323	CLIP-seq
MIRT1010234	hsa-miR-454	CLIP-seq
MIRT2232903	hsa-miR-4690-3p	CLIP-seq
MIRT2232904	hsa-miR-4797-3p	CLIP-seq
MIRT2232905	hsa-miR-4797-5p	CLIP-seq
MIRT1010237	hsa-miR-495	CLIP-seq
MIRT1010241	hsa-miR-519a	CLIP-seq
MIRT1010242	hsa-miR-519b-3p	CLIP-seq
MIRT1010243	hsa-miR-519c-3p	CLIP-seq
MIRT2232906	hsa-miR-622	CLIP-seq
MIRT2232907	hsa-miR-720	CLIP-seq
MIRT1010245	hsa-miR-802	CLIP-seq
MIRT1999209	hsa-miR-891b	CLIP-seq
MIRT1010231	hsa-miR-4258	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12052864, 16256071, 25314077, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9827804
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9827804
GO:0006915	Process	Apoptotic process	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9827804
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	9827804
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	9827804
GO:1900745	Process	Positive regulation of p38MAPK cascade	IEA

Other IDs

• MIM: 604948
• HGNC: 4096
• e!Ensembl: ENSG00000099860

Protein

• UniProt ID: O75293
• Protein name: Growth arrest and DNA damage-inducible protein GADD45 beta (Myeloid differentiation primary response protein MyD118) (Negative growth regulatory protein MyD118)
• Protein function: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01248	Ribosomal_L7Ae	21 → 121	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family	Domain

• Sequence:

  MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
  IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
  LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

• Sequence length: 160

Pathways

KEGG:

MAPK signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Apoptosis
Cellular senescence
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23111975		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	21352821		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	26993769		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36646969	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19877043		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26792343, 36238290	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	18378158	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18378158	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	30912292	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15642734	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23237561	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23110778, 37608794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12759252, 27177086	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15509538, 17591973, 17711513, 18225533, 35699863, 39273406	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28870783		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27164935	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37165780	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	18515079		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31043581		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31043581		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29435034		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	20942912	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12406558, 12759252		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23110778		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23110778, 27316467, 30537927	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29435034		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18576389		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36092962	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23793925		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23793925		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16026601	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37657050	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	37608794	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	23616123		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26881536	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	33936064	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	26283340	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	26993769	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	38212812	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27177086	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31952466	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	27852859		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	12759252		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	12759252	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	26993769		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12759252, 15509538, 17591973, 17711513, 18225533, 21062976, 27134688, 29716964, 31351327		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12759252		★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	21352821	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31195707		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22473939	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22473939		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23793925		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12759252		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28870783		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29356020		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15509538, 16026601, 17591973, 19834918		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12406558, 12759252		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38070141	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29572137	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30279966		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21810943, 23110778, 24190252, 28870783, 29356020, 31296259		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24190252		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31296259		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	22048458		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	22048458, 22802593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	26618897	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17900349, 26618897	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31311554		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28407786, 29170526, 40313149	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24476546		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	31311554		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	31678370		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	31156709		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29356020		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17878531, 20699414	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20699414		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	22048458		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	22048458, 22802593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22409248	Inhibit	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	26792343		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19877043, 26792343, 31195707		★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	22183150	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35936362, 37608794, 37662480	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	19877043		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	30787364		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32425887	Inhibit	★☆☆☆☆ Found in Text Mining only