MYBL2 (MYB proto-oncogene like 2)

Gene

• Entrez ID: 4605
• Gene name: MYB proto-oncogene like 2
• Gene symbol: MYBL2
• Synonyms (NCBI Gene): B-MYB, BMYB
• Chromosome: 20
• Chromosome location: 20q13.12
• Summary: The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006045	hsa-miR-30e-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21187425
MIRT006045	hsa-miR-30e-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21187425
MIRT006045	hsa-miR-30e-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21187425
MIRT021213	hsa-miR-149-3p	Reporter assay;Western blot;qRT-PCR	20623644
MIRT049701	hsa-miR-92a-3p	CLASH	23622248
MIRT041019	hsa-miR-505-3p	CLASH	23622248
MIRT038033	hsa-miR-423-5p	CLASH	23622248
MIRT437542	hsa-miR-19b-3p	Immunoprecipitaion	22382630
MIRT727125	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727124	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727123	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727122	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT006045	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT021213	hsa-miR-149-3p	PAR-CLIP	27292025
MIRT038033	hsa-miR-423-5p	PAR-CLIP	27292025
MIRT736221	hsa-miR-29b-2-5p	RNA-seq, qRT-PCR	33808771
MIRT1167644	hsa-miR-1205	CLIP-seq
MIRT1167645	hsa-miR-1207-3p	CLIP-seq
MIRT1167646	hsa-miR-1286	CLIP-seq
MIRT1167647	hsa-miR-1291	CLIP-seq
MIRT1167648	hsa-miR-138	CLIP-seq
MIRT1167649	hsa-miR-146b-3p	CLIP-seq
MIRT1167650	hsa-miR-29a	CLIP-seq
MIRT1167651	hsa-miR-29b	CLIP-seq
MIRT1167652	hsa-miR-29c	CLIP-seq
MIRT1167653	hsa-miR-30a	CLIP-seq
MIRT1167654	hsa-miR-30b	CLIP-seq
MIRT1167655	hsa-miR-30c	CLIP-seq
MIRT1167656	hsa-miR-30d	CLIP-seq
MIRT1167657	hsa-miR-30e	CLIP-seq
MIRT1167658	hsa-miR-3152-5p	CLIP-seq
MIRT1167659	hsa-miR-3184	CLIP-seq
MIRT1167660	hsa-miR-328	CLIP-seq
MIRT1167661	hsa-miR-3607-3p	CLIP-seq
MIRT1167662	hsa-miR-3613-3p	CLIP-seq
MIRT1167663	hsa-miR-3663-3p	CLIP-seq
MIRT1167664	hsa-miR-378g	CLIP-seq
MIRT1167665	hsa-miR-4423-5p	CLIP-seq
MIRT1167666	hsa-miR-4436b-3p	CLIP-seq
MIRT1167667	hsa-miR-4437	CLIP-seq
MIRT1167668	hsa-miR-4632	CLIP-seq
MIRT1167669	hsa-miR-4674	CLIP-seq
MIRT1167670	hsa-miR-4717-3p	CLIP-seq
MIRT1167671	hsa-miR-4722-5p	CLIP-seq
MIRT1167672	hsa-miR-4733-3p	CLIP-seq
MIRT1167673	hsa-miR-4792	CLIP-seq
MIRT1167674	hsa-miR-501-3p	CLIP-seq
MIRT1167675	hsa-miR-502-3p	CLIP-seq
MIRT1167676	hsa-miR-580	CLIP-seq
MIRT1167677	hsa-miR-590-3p	CLIP-seq
MIRT1167678	hsa-miR-665	CLIP-seq
MIRT1167679	hsa-miR-767-5p	CLIP-seq
MIRT1167680	hsa-miR-939	CLIP-seq
MIRT2048361	hsa-miR-1182	CLIP-seq
MIRT2048362	hsa-miR-1273f	CLIP-seq
MIRT2048363	hsa-miR-143	CLIP-seq
MIRT2048364	hsa-miR-1913	CLIP-seq
MIRT2048365	hsa-miR-27a	CLIP-seq
MIRT2048366	hsa-miR-27b	CLIP-seq
MIRT1167650	hsa-miR-29a	CLIP-seq
MIRT1167651	hsa-miR-29b	CLIP-seq
MIRT1167652	hsa-miR-29c	CLIP-seq
MIRT1167653	hsa-miR-30a	CLIP-seq
MIRT1167654	hsa-miR-30b	CLIP-seq
MIRT1167655	hsa-miR-30c	CLIP-seq
MIRT1167656	hsa-miR-30d	CLIP-seq
MIRT1167657	hsa-miR-30e	CLIP-seq
MIRT2048367	hsa-miR-324-3p	CLIP-seq
MIRT2048368	hsa-miR-331-3p	CLIP-seq
MIRT1167661	hsa-miR-3607-3p	CLIP-seq
MIRT2048369	hsa-miR-361-3p	CLIP-seq
MIRT2048370	hsa-miR-3661	CLIP-seq
MIRT1167663	hsa-miR-3663-3p	CLIP-seq
MIRT2048371	hsa-miR-4251	CLIP-seq
MIRT2048372	hsa-miR-4313	CLIP-seq
MIRT2048373	hsa-miR-4329	CLIP-seq
MIRT2048374	hsa-miR-4330	CLIP-seq
MIRT1167667	hsa-miR-4437	CLIP-seq
MIRT2048375	hsa-miR-4514	CLIP-seq
MIRT1167668	hsa-miR-4632	CLIP-seq
MIRT2048376	hsa-miR-4640-3p	CLIP-seq
MIRT2048377	hsa-miR-4645-5p	CLIP-seq
MIRT2048378	hsa-miR-4650-5p	CLIP-seq
MIRT2048379	hsa-miR-4673	CLIP-seq
MIRT1167669	hsa-miR-4674	CLIP-seq
MIRT2048380	hsa-miR-4692	CLIP-seq
MIRT2048381	hsa-miR-4701-5p	CLIP-seq
MIRT2048382	hsa-miR-4708-5p	CLIP-seq
MIRT1167672	hsa-miR-4733-3p	CLIP-seq
MIRT2048383	hsa-miR-4755-3p	CLIP-seq
MIRT2048384	hsa-miR-4770	CLIP-seq
MIRT1167673	hsa-miR-4792	CLIP-seq
MIRT2048385	hsa-miR-4795-5p	CLIP-seq
MIRT2048386	hsa-miR-513a-5p	CLIP-seq
MIRT1167676	hsa-miR-580	CLIP-seq
MIRT2048387	hsa-miR-588	CLIP-seq
MIRT2048388	hsa-miR-619	CLIP-seq
MIRT2048389	hsa-miR-631	CLIP-seq
MIRT1167678	hsa-miR-665	CLIP-seq
MIRT1167680	hsa-miR-939	CLIP-seq
MIRT2048364	hsa-miR-1913	CLIP-seq
MIRT2048365	hsa-miR-27a	CLIP-seq
MIRT2048366	hsa-miR-27b	CLIP-seq
MIRT1167653	hsa-miR-30a	CLIP-seq
MIRT1167654	hsa-miR-30b	CLIP-seq
MIRT1167655	hsa-miR-30c	CLIP-seq
MIRT1167656	hsa-miR-30d	CLIP-seq
MIRT1167657	hsa-miR-30e	CLIP-seq
MIRT2048367	hsa-miR-324-3p	CLIP-seq
MIRT1167661	hsa-miR-3607-3p	CLIP-seq
MIRT2048372	hsa-miR-4313	CLIP-seq
MIRT2048374	hsa-miR-4330	CLIP-seq
MIRT2048376	hsa-miR-4640-3p	CLIP-seq
MIRT2048386	hsa-miR-513a-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	14618416;16299810
MYBL2	Unknown	15922873
MYCN	Activation	21304178
SP1	Unknown	15922873
TFDP1	Activation	14618416

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10770937
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10770937
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	17159899, 17531812, 19725879, 25557911, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0031523	Component	Myb complex	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10770937
GO:0090307	Process	Mitotic spindle assembly	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 601415
• HGNC: 7548
• e!Ensembl: ENSG00000101057

Protein

• UniProt ID: P10244
• Protein name: Myb-related protein B (B-Myb) (Myb-like protein 2)
• Protein function: Transcription factor involved in the regulation of cell survival, proliferation, and differentiation. Transactivates the expression of the CLU gene.
• PDB: 6C48
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13921	Myb_DNA-bind_6	34 → 94		Domain
  PF00249	Myb_DNA-binding	135 → 180	Myb-like DNA-binding domain	Domain
  PF09316	Cmyb_C	451 → 607	C-myb, C-terminal	Family

• Sequence:

  MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASH
  FPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ
  CRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTI
  KRKVDTGGFLSESKDCKPPVYLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEEN
  SEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQEGSPPETSLPYKWVVEAANLL
  IPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQASHQQQVLPPRQ
  PSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL
  SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCS
  QKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPH
  LEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMS
  TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMS
  SAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

• Sequence length: 700

Pathways

KEGG:

Cellular senescence

Reactome:

Polo-like kinase mediated events
TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31758653		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28559119		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	36115056	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31756170		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19043454, 19383908, 21630024, 21969598, 22037783, 24349128, 25337223, 25502082, 28061449, 29268817		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19043454, 20864510, 24349128, 26510790, 28061449, 28276478, 28697743, 29268817, 30358191, 32925947, 34585645, 34588717, 35341461	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31280346, 35135230	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24289849, 28555007, 30321399, 33765507, 39766782	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	33335279	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24349128, 31737652, 34585645, 35135230, 35176941, 36494680, 36685007	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	33335279	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31756170		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28555007		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32951068	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30206359		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21270603, 24141769, 31819492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21270603		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21270603, 24141769, 31819492		★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	28427077		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21367750		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34585645	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	19016757		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19016757	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30985693, 35135230, 37386467, 38064496	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33133095	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22378275, 26308378		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33782625	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28427077		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28784180		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32696617, 32974985	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28784180		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28784180		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28784180, 32696617, 33765507, 34585645, 36776924, 39684661	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36133745	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30206359	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11080802		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35135230	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21367750, 24199710, 31387917		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21419759, 21480327, 24349128, 29274707, 30936457		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28555007	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38522681	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12393503	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19043454, 19383908, 21630024, 21969598, 22037783, 24349128, 25337223, 25502082, 28061449, 29268817		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22378275		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28427077		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28555007		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30206359		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30809094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31756170		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10228942, 10744766, 16198555, 16914089, 18026132, 21304178, 21419759, 21828240, 23878725, 24199710, 28559119, 30206359		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21270603, 24141769, 31819492		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19043454		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22910183, 23878725, 30082276		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23878725	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29049183	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29328450		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10438845, 18026132, 19383908, 22910183, 23878725, 24289849, 25273528, 25999348, 27090638, 28555007, 28559119, 28784180, 29434747, 29772705, 30321399, 30809094, 30881043, 31115881, 31280346, 31819492		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10770937, 11973331, 22619121, 9361185		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21304178, 22619121, 28467792, 35135230, 7721753	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28555007, 29434747, 29772705, 31681566		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33749514	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30206359		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11071270	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28559119		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35387554	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33897882, 36087093	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17182682, 9361185		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	32084007	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	14613485, 8752671		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	12393503		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30881043		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33787061	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30809094		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34358419	Stimulate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	14613485, 8752671		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	32887540	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	20864510, 33835503	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35135230	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21270603	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21270603	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33302814	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	27090638		★☆☆☆☆ Found in Text Mining only