Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4602
Gene name	MYB proto-oncogene, transcription factor
Gene symbol	MYB
Synonyms (NCBI Gene)	Cmybc-mybc-myb_CDSefg
Chromosome	6
Chromosome location	6q23.3
Summary	This gene encodes a protein with three HTH DNA-binding domains that functions as a transcription regulator. This protein plays an essential role in the regulation of hematopoiesis. This gene may be aberrently expressed or rearranged or undergo translocati

355

Show/Hide all (355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000747	hsa-miR-34b-5p	ReviewMicroarray	19461653
MIRT000746	hsa-miR-34c-5p	ReviewMicroarray	19461653
MIRT000720	hsa-miR-34a-5p	qRT-PCRWestern blotLuciferase reporter assay	19584398
MIRT000720	hsa-miR-34a-5p	qRT-PCRWestern blotLuciferase reporter assay	19584398
MIRT000720	hsa-miR-34a-5p	qRT-PCRWestern blotLuciferase reporter assay	19584398
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayWestern blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayWestern blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayWestern blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayWestern blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blot	18814950
MIRT003539	rno-miR-150-5p	qRT-PCRWestern blot	19892940
MIRT004637	hsa-miR-16-5p	Review	20029422
MIRT000935	hsa-miR-150-5p	Review	20029422
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assayWestern blot	18818396
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assayWestern blot	18818396
MIRT003802	hsa-miR-107	Luciferase reporter assayWestern blot	18818396
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assayMicroarrayqRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assayMicroarrayqRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assayMicroarrayqRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assayMicroarrayqRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assayMicroarrayqRT-PCR	21205891
MIRT005884	hsa-miR-155-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005884	hsa-miR-155-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005884	hsa-miR-155-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005884	hsa-miR-155-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005886	hsa-miR-424-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005886	hsa-miR-424-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005886	hsa-miR-424-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT005886	hsa-miR-424-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	21062812
MIRT000935	hsa-miR-150-5p	qRT-PCRWestern blot	21590770
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	20603081
MIRT016588	hsa-miR-193b-3p	Microarray	20304954
MIRT005884	hsa-miR-155-5p	Reporter assay	20680360
MIRT000935	hsa-miR-150-5p	Reporter assay	17923094
MIRT000935	hsa-miR-150-5p	Reporter assay;Western blot;Other	18667440
MIRT024449	hsa-miR-215-5p	Microarray	19074876
MIRT000720	hsa-miR-34a-5p	Proteomics	21566225
MIRT026025	hsa-miR-198	qRT-PCR	18667440
MIRT026947	hsa-miR-192-5p	Microarray	19074876
MIRT042569	hsa-miR-423-3p	CLASH	23622248
MIRT052922	hsa-miR-200a-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	22101269
MIRT052922	hsa-miR-200a-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	22101269
MIRT052922	hsa-miR-200a-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	22101269
MIRT052923	hsa-miR-200b-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	22101269
MIRT052923	hsa-miR-200b-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	22101269
MIRT052923	hsa-miR-200b-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	22101269
MIRT000935	hsa-miR-150-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22025269
MIRT052923	hsa-miR-200b-3p	Luciferase reporter assayWestern blot	22101269
MIRT052964	hsa-miR-200c-3p	Luciferase reporter assayWestern blot	22101269
MIRT052965	hsa-miR-429	Luciferase reporter assayWestern blot	22101269
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayMicroarrayqRT-PCR	23604034
MIRT005886	hsa-miR-424-5p	Luciferase reporter assayqRT-PCRWestern blot	24675898
MIRT053183	hsa-miR-150-3p	and Hep3B)"	22025269
MIRT053183	hsa-miR-150-3p	and Hep3B)"	22025269
MIRT005884	hsa-miR-155-5p	Microarray	23807165
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assayqRT-PCRWestern blot	25530421
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assayqRT-PCRWestern blot	25530421
MIRT000935	hsa-miR-150-5p	ImmunohistochemistryIn situ hybridizationMicroarrayqRT-PCRWestern blot	24613688
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blot	24438945
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blot	24438945
MIRT054890	hsa-miR-195-5p	Luciferase reporter assayqRT-PCRWestern blot	24486218
MIRT054890	hsa-miR-195-5p	Luciferase reporter assayqRT-PCRWestern blot	24486218
MIRT000935	hsa-miR-150-5p	Luciferase reporter assayMicroarray	24086639
MIRT000935	hsa-miR-150-5p	FlowqRT-PCRWestern blot	23521217
MIRT000720	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT438084	hsa-miR-105-5p	Luciferase reporter assayqRT-PCRWestern blot	24446170
MIRT000720	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT438084	hsa-miR-105-5p	Luciferase reporter assayqRT-PCRWestern blot	24446170
MIRT016588	hsa-miR-193b-3p	Luciferase reporter assay	25231743
MIRT016588	hsa-miR-193b-3p	Luciferase reporter assay	25231743
MIRT016588	hsa-miR-193b-3p	Luciferase reporter assay	25231743
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCRWestern blot	28337280
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCRWestern blot	28337280
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCRWestern blot	28337280
MIRT000283	hsa-miR-106a-5p	Luciferase reporter assay	26265888
MIRT000283	hsa-miR-106a-5p	Luciferase reporter assay	26265888
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assayWestern blot	27888798
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assayWestern blot	27888798
MIRT006604	hsa-miR-150-5p	qRT-PCR	32490599
MIRT006604	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blotting	31570789
MIRT755672	hsa-miR-200c-5p	Luciferase reporter assayWestern blottingqRT-PCR	37807322
MIRT756197	hsa-miR-187-5p	Luciferase reporter assayWestern blotting	35096852
MIRT1167328	hsa-miR-103a	CLIP-seq
MIRT1167329	hsa-miR-105	CLIP-seq
MIRT1167330	hsa-miR-124	CLIP-seq
MIRT1167331	hsa-miR-1243	CLIP-seq
MIRT1167332	hsa-miR-1245	CLIP-seq
MIRT1167333	hsa-miR-1264	CLIP-seq
MIRT1167334	hsa-miR-1267	CLIP-seq
MIRT1167335	hsa-miR-1273d	CLIP-seq
MIRT1167336	hsa-miR-130a	CLIP-seq
MIRT1167337	hsa-miR-130b	CLIP-seq
MIRT1167338	hsa-miR-134	CLIP-seq
MIRT1167339	hsa-miR-139-5p	CLIP-seq
MIRT1167340	hsa-miR-140-3p	CLIP-seq
MIRT1167341	hsa-miR-148a	CLIP-seq
MIRT1167342	hsa-miR-148b	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167344	hsa-miR-152	CLIP-seq
MIRT1167345	hsa-miR-153	CLIP-seq
MIRT1167346	hsa-miR-155	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167350	hsa-miR-1911	CLIP-seq
MIRT1167351	hsa-miR-1913	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT1167353	hsa-miR-200b	CLIP-seq
MIRT1167354	hsa-miR-200c	CLIP-seq
MIRT1167355	hsa-miR-2116	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167357	hsa-miR-298	CLIP-seq
MIRT1167358	hsa-miR-301a	CLIP-seq
MIRT1167359	hsa-miR-301b	CLIP-seq
MIRT1167360	hsa-miR-3118	CLIP-seq
MIRT1167361	hsa-miR-3140-3p	CLIP-seq
MIRT1167362	hsa-miR-3148	CLIP-seq
MIRT1167363	hsa-miR-3187-3p	CLIP-seq
MIRT1167364	hsa-miR-324-3p	CLIP-seq
MIRT1167365	hsa-miR-34a	CLIP-seq
MIRT1167366	hsa-miR-3591-3p	CLIP-seq
MIRT1167367	hsa-miR-3591-5p	CLIP-seq
MIRT1167368	hsa-miR-3606	CLIP-seq
MIRT1167369	hsa-miR-3609	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167371	hsa-miR-3616-5p	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167373	hsa-miR-3647-5p	CLIP-seq
MIRT1167374	hsa-miR-3654	CLIP-seq
MIRT1167375	hsa-miR-3666	CLIP-seq
MIRT1167376	hsa-miR-3667-5p	CLIP-seq
MIRT1167377	hsa-miR-3691-3p	CLIP-seq
MIRT1167378	hsa-miR-369-5p	CLIP-seq
MIRT1167379	hsa-miR-3714	CLIP-seq
MIRT1167380	hsa-miR-371-5p	CLIP-seq
MIRT1167381	hsa-miR-371b-5p	CLIP-seq
MIRT1167382	hsa-miR-3910	CLIP-seq
MIRT1167383	hsa-miR-3912	CLIP-seq
MIRT1167384	hsa-miR-3923	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT1167386	hsa-miR-4255	CLIP-seq
MIRT1167387	hsa-miR-4275	CLIP-seq
MIRT1167388	hsa-miR-4276	CLIP-seq
MIRT1167389	hsa-miR-4295	CLIP-seq
MIRT1167390	hsa-miR-4438	CLIP-seq
MIRT1167391	hsa-miR-4477a	CLIP-seq
MIRT1167392	hsa-miR-449a	CLIP-seq
MIRT1167393	hsa-miR-449b	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167396	hsa-miR-4529-5p	CLIP-seq
MIRT1167397	hsa-miR-454	CLIP-seq
MIRT1167398	hsa-miR-4635	CLIP-seq
MIRT1167399	hsa-miR-4652-3p	CLIP-seq
MIRT1167400	hsa-miR-4661-5p	CLIP-seq
MIRT1167401	hsa-miR-4662a-3p	CLIP-seq
MIRT1167402	hsa-miR-4671-3p	CLIP-seq
MIRT1167403	hsa-miR-4677-5p	CLIP-seq
MIRT1167404	hsa-miR-4711-5p	CLIP-seq
MIRT1167405	hsa-miR-4713-5p	CLIP-seq
MIRT1167406	hsa-miR-4717-3p	CLIP-seq
MIRT1167407	hsa-miR-4733-5p	CLIP-seq
MIRT1167408	hsa-miR-4749-3p	CLIP-seq
MIRT1167409	hsa-miR-4760-3p	CLIP-seq
MIRT1167410	hsa-miR-4766-5p	CLIP-seq
MIRT1167411	hsa-miR-4782-5p	CLIP-seq
MIRT1167412	hsa-miR-4786-5p	CLIP-seq
MIRT1167413	hsa-miR-4794	CLIP-seq
MIRT1167414	hsa-miR-4795-5p	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167417	hsa-miR-506	CLIP-seq
MIRT1167418	hsa-miR-5095	CLIP-seq
MIRT1167419	hsa-miR-512-3p	CLIP-seq
MIRT1167420	hsa-miR-513a-3p	CLIP-seq
MIRT1167421	hsa-miR-513a-5p	CLIP-seq
MIRT1167422	hsa-miR-519a	CLIP-seq
MIRT1167423	hsa-miR-519b-3p	CLIP-seq
MIRT1167424	hsa-miR-519c-3p	CLIP-seq
MIRT1167425	hsa-miR-532-3p	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167427	hsa-miR-548ac	CLIP-seq
MIRT1167428	hsa-miR-548ah	CLIP-seq
MIRT1167429	hsa-miR-548d-3p	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT1167431	hsa-miR-548t	CLIP-seq
MIRT1167432	hsa-miR-548z	CLIP-seq
MIRT1167433	hsa-miR-568	CLIP-seq
MIRT1167434	hsa-miR-573	CLIP-seq
MIRT1167435	hsa-miR-579	CLIP-seq
MIRT1167436	hsa-miR-592	CLIP-seq
MIRT1167437	hsa-miR-597	CLIP-seq
MIRT1167438	hsa-miR-607	CLIP-seq
MIRT1167439	hsa-miR-643	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167441	hsa-miR-664	CLIP-seq
MIRT1167442	hsa-miR-769-5p	CLIP-seq
MIRT1167443	hsa-miR-891a	CLIP-seq
MIRT1167444	hsa-miR-892b	CLIP-seq
MIRT1167445	hsa-miR-921	CLIP-seq
MIRT1167446	hsa-miR-934	CLIP-seq
MIRT1167329	hsa-miR-105	CLIP-seq
MIRT1167447	hsa-miR-1252	CLIP-seq
MIRT1167448	hsa-miR-1256	CLIP-seq
MIRT1167449	hsa-miR-1271	CLIP-seq
MIRT1167450	hsa-miR-1305	CLIP-seq
MIRT1167340	hsa-miR-140-3p	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167451	hsa-miR-182	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT1167452	hsa-miR-25	CLIP-seq
MIRT1167357	hsa-miR-298	CLIP-seq
MIRT1167362	hsa-miR-3148	CLIP-seq
MIRT1167453	hsa-miR-3163	CLIP-seq
MIRT1167454	hsa-miR-32	CLIP-seq
MIRT1167455	hsa-miR-340	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167456	hsa-miR-363	CLIP-seq
MIRT1167457	hsa-miR-367	CLIP-seq
MIRT1167458	hsa-miR-3671	CLIP-seq
MIRT1167459	hsa-miR-3678-3p	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167460	hsa-miR-4642	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167461	hsa-miR-520d-5p	CLIP-seq
MIRT1167462	hsa-miR-524-5p	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT1167435	hsa-miR-579	CLIP-seq
MIRT1167438	hsa-miR-607	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167463	hsa-miR-92a	CLIP-seq
MIRT1167464	hsa-miR-92b	CLIP-seq
MIRT1167465	hsa-miR-96	CLIP-seq
MIRT1167328	hsa-miR-103a	CLIP-seq
MIRT1167339	hsa-miR-139-5p	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167376	hsa-miR-3667-5p	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT1167390	hsa-miR-4438	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167400	hsa-miR-4661-5p	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167418	hsa-miR-5095	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167446	hsa-miR-934	CLIP-seq
MIRT1167328	hsa-miR-103a	CLIP-seq
MIRT1167329	hsa-miR-105	CLIP-seq
MIRT1167336	hsa-miR-130a	CLIP-seq
MIRT1167337	hsa-miR-130b	CLIP-seq
MIRT1167339	hsa-miR-139-5p	CLIP-seq
MIRT1167340	hsa-miR-140-3p	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT2048343	hsa-miR-2355-5p	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167358	hsa-miR-301a	CLIP-seq
MIRT1167359	hsa-miR-301b	CLIP-seq
MIRT2048344	hsa-miR-3065-5p	CLIP-seq
MIRT2048345	hsa-miR-3120-5p	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167375	hsa-miR-3666	CLIP-seq
MIRT1167376	hsa-miR-3667-5p	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT2048346	hsa-miR-4251	CLIP-seq
MIRT2048347	hsa-miR-4277	CLIP-seq
MIRT1167389	hsa-miR-4295	CLIP-seq
MIRT2048348	hsa-miR-4303	CLIP-seq
MIRT2048349	hsa-miR-4329	CLIP-seq
MIRT2048350	hsa-miR-433	CLIP-seq
MIRT1167390	hsa-miR-4438	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167397	hsa-miR-454	CLIP-seq
MIRT1167399	hsa-miR-4652-3p	CLIP-seq
MIRT2048351	hsa-miR-4659a-3p	CLIP-seq
MIRT2048352	hsa-miR-4659b-3p	CLIP-seq
MIRT1167400	hsa-miR-4661-5p	CLIP-seq
MIRT2048353	hsa-miR-4684-3p	CLIP-seq
MIRT2048354	hsa-miR-4709-5p	CLIP-seq
MIRT1167405	hsa-miR-4713-5p	CLIP-seq
MIRT2048355	hsa-miR-4775	CLIP-seq
MIRT1167412	hsa-miR-4786-5p	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167418	hsa-miR-5095	CLIP-seq
MIRT2048356	hsa-miR-518a-5p	CLIP-seq
MIRT2048357	hsa-miR-527	CLIP-seq
MIRT1167425	hsa-miR-532-3p	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT2048358	hsa-miR-590-3p	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167442	hsa-miR-769-5p	CLIP-seq
MIRT1167446	hsa-miR-934	CLIP-seq
MIRT2048359	hsa-miR-942	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167336	hsa-miR-130a	CLIP-seq
MIRT1167337	hsa-miR-130b	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167358	hsa-miR-301a	CLIP-seq
MIRT1167359	hsa-miR-301b	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167375	hsa-miR-3666	CLIP-seq
MIRT1167389	hsa-miR-4295	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT1167397	hsa-miR-454	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT2048354	hsa-miR-4709-5p	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT2454656	hsa-miR-548c-3p	CLIP-seq
MIRT2576112	hsa-miR-3614-5p	CLIP-seq
MIRT2576113	hsa-miR-3907	CLIP-seq
MIRT2576114	hsa-miR-4272	CLIP-seq
MIRT2576115	hsa-miR-4325	CLIP-seq
MIRT2576112	hsa-miR-3614-5p	CLIP-seq
MIRT2576113	hsa-miR-3907	CLIP-seq
MIRT2576114	hsa-miR-4272	CLIP-seq
MIRT2576115	hsa-miR-4325	CLIP-seq

Show/Hide all (16)

Transcription factor	Regulation	Reference
BCL3	Unknown	9694711
E2F1	Unknown	8137237
EGR1	Repression	7559553
ETS1	Activation	7848925
FOSL2	Activation	22493372
IRF1	Repression	10739671
JUN	Unknown	1527086
JUND	Activation	22493372
JUND	Repression	18071306
JUND	Unknown	1527086
MYB	Unknown	7655015
TAL1	Activation	22897851
TWIST1	Repression	19051271
TWIST2	Repression	19051271
WT1	Repression	7559553
ZFHX3	Repression	15750593

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20531406
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	7987850, 25857263
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10233885, 25857263
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	18093978, 18548008, 20195357, 20484083, 20802522, 25394790, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20829347
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	2189102
GO:0006816	Process	Calcium ion transport	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014856	Process	Skeletal muscle cell proliferation	IEA
GO:0016363	Component	Nuclear matrix	NAS	3014652
GO:0017145	Process	Stem cell division	IEA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IMP	25857263
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IMP	20484083
GO:0045653	Process	Negative regulation of megakaryocyte differentiation	IMP	25857263
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20531406
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20531406
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	2189102
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	EXP	11792321
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10233885, 20484083, 25857263
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20484083, 20531406
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048566	Process	Embryonic digestive tract development	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0061515	Process	Myeloid cell development	NAS	7684005
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071636	Process	Positive regulation of transforming growth factor beta production	IEA
GO:0071987	Function	WD40-repeat domain binding	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	11792321
GO:1901533	Process	Negative regulation of hematopoietic progenitor cell differentiation	IMP	28111278
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	25857263
GO:1904899	Process	Positive regulation of hepatic stellate cell proliferation	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000491	Process	Positive regulation of hepatic stellate cell activation	IEA
GO:2000845	Process	Positive regulation of testosterone secretion	IEA

MIM	HGNC	e!Ensembl
189990	7545	ENSG00000118513

P10242

Protein name

Transcriptional activator Myb (Proto-oncogene c-Myb)

Protein function

Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00249	Myb_DNA-binding	92 → 138	Myb-like DNA-binding domain	Domain
PF00249	Myb_DNA-binding	144 → 189	Myb-like DNA-binding domain	Domain
PF07988	LMSTEN	267 → 313	LMSTEN motif	Motif
PF09316	Cmyb_C	399 → 563	C-myb, C-terminal	Family

Sequence

MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT
STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIK
YGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF
FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP
LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM

Sequence length

640

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway		RUNX1 regulates transcription of genes involved in differentiation of HSCs Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOCENTRIC GLIOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOGLOBIN E DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYB-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (211)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	28418072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Basophilic Leukemia	Basophilic Leukemia	ORPHANET_DG	21474671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute basophilic leukemia	Basophilic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Basophilic Leukemia	Basophilic Leukemia	BEFREE	30599775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	11896618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24504520, 3014652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1560675, 16029452, 29233926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23340802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	15540222, 18818702, 8630096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30335887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21901247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	BEFREE	28727172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	19841262, 20452298, 20702610, 21164292, 21324728, 21572406, 21618541, 21785271, 21901247, 22015727, 22505352, 23222122, 23398044, 23725736, 23778135 View all (38 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	23685749, 26829750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15595638, 25934694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	BEFREE	28727172, 31189999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	11848471, 30623377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18095118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	17452517, 19737967, 27307595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19841262, 20702610, 21324728, 21618541, 21709671, 21785271, 21901247, 21976542, 22505352, 23685749, 23725736, 23825564, 24893972, 25217885, 25587024 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	20702610, 24302647, 24893972, 26631609, 28085142, 28719465, 29978608, 31857685, 34011559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	21785271	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	31758945		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	19696200, 23606168, 24581976		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	19696200, 23606168, 24581976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29135517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	29879141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	18667698, 21068433, 21205891, 24614105, 24667352, 25084696, 25928412, 28332727, 29879141, 38339995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	18667698, 19148297, 20472475, 21057501, 21205891, 25084696, 25457385, 25928412, 28332727, 29704633, 29879141, 30216683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiocentric glioma	Angiocentric Glioma	BEFREE	26829751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angiocentric glioma	Angiocentric Glioma	ORPHANET_DG	26829751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angiocentric glioma	Angiocentric Glioma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19841262, 20702610, 21324728, 21618541, 21709671, 21785271, 21901247, 21976542, 22505352, 23685749, 23725736, 23825564, 24893972, 25217885, 25587024 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Apparent Mineralocorticoid Excess	BEFREE	30003572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CTD_human_DG	19198610		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	23606399		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	23606399	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	21046410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21046410	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23881924, 26810070, 31563982, 36074655, 37165121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	17452517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34938350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29099869		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	18697826, 20472475, 21068433, 21205891, 29704633		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	19696200, 21068433, 21205891, 21385855, 22271886, 24614105, 25928412, 27009595, 28280727, 34795208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Beta thalassemia intermedia	beta Thalassemia	BEFREE	20472475		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	18697826, 20472475, 21068433, 21205891, 29704633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	16797705, 21501493, 9737692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	LHGDN	16797705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	23199169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29675107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	36074655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10597254, 11034064, 16977606, 17690249, 18476782, 18574464, 20659323, 21482760, 2181374, 22101269, 22492511, 26812885, 30971760, 31391555, 31406165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17690249, 19036881, 19841262, 20043041, 20237898, 20547751, 20949095, 21261996, 21482760, 22492511, 23098454, 23935942, 24067373, 24283570, 24297604 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23237561	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23521217, 29415639, 35205272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20949095, 22492511, 24675898, 31483290, 34719326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19841262, 26089205, 28323779, 28664668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	19841262, 20702610, 20978318, 21164292, 21324728, 21572406, 21785271, 21976542, 23398044, 23778135, 23778141, 24302647, 24576033, 24732452, 25951887 View all (38 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	31189999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21190594, 24675898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26089205, 28323779, 29882219, 31189999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	25804118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31570789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	23606399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18095118		★★★★★ ★☆☆☆☆ Found in Text Mining only
CHROMOSOME 8p11 MYELOPROLIFERATIVE SYNDROME	8p11 Myeloproliferative Syndrome	BEFREE	31628193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	22579713, 25849990, 27748374, 29047144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11410788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11848471, 17690249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15001837	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16977606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17690249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11848471, 15595638, 16977606, 18386000, 19609274, 20027603, 30623377, 31205515, 31338937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11290547, 15001837, 20237898, 26873484, 26934556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34286904	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	26969893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	23483952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15221349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15221349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15221349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	20124286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	8183937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eccrine dermal cylindroma	Cylindromatosis	BEFREE	21618541, 26969893, 27185061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	28085142, 31483290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25222228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32802844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	19860791, 23606399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	23606399, 38010473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	24581976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	22882594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	21572406, 2578097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	24581976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	29135517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	27491809, 29149504, 35590093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	37660928	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	29582677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28405803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	2354420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	7688794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	2354420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21046410, 26810070, 28575485, 31038238, 31563982, 36074655, 36776924, 37165121, 40702569	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	22230766, 28575485		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	23583981, 26829751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25963073, 39218775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	27457538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	10378698, 1630821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25951887, 29149504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	35205272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26934556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis Epidermolytic	Epidermolytic hyperkeratosis	Pubtator	37929023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	29214365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	23483952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	25915923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10671493, 1451597, 1495997, 16421272, 18056083, 18195038, 19841262, 2006173, 20237898, 21261996, 21795403, 21853052, 22051105, 2506946, 2541445 View all (12 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11552989, 15540222, 1560675, 18574464, 19841262, 20237898, 20925909, 2144164, 21853052, 22051105, 29233926, 29317678, 29675107, 29704633, 30177851, 31138842, 8039161 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17452517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20925909	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	15187020, 2541445, 33637692, 38462943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10590070, 1371419, 2006173, 21364958, 22110127, 25924238, 29316424, 30177851, 31164492, 33527899, 33958723, 35368048, 35406726, 35709529, 35743167, 36913305, 38462943 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15187020	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	21828134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	35653587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16029452, 23340802, 24121269, 25860293, 25982114, 29089643, 29316427, 29317678, 29854289, 30177851, 31138842, 3281804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	21828134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17452517, 20647765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30133116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	31948396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22253833, 28754957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	3701256	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11319807, 23910958, 8039161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18195038, 32526676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	29666007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	23583981, 26829751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	29675107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10597254, 11034064, 16977606, 17690249, 18476782, 18574464, 20237898, 20659323, 21261996, 21482760, 2181374, 22101269, 22492511, 26812885, 2915899, 30971760, 31391555, 31406165 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31066170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31570789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26657649, 27246849, 27354262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24847116, 30863497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30370523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10378701, 10744766, 17452517, 17690006, 18026132, 19841262, 20027603, 20647765, 2204478, 23778141, 2487149, 26631609, 27185061, 27307595, 27354262 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11410788, 16977606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11034064, 17690249, 18476782, 20659323, 22492511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	16783165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18095118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	19404853, 22211292		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19404853, 22211292, 2487149, 26999337, 8183937, 9372243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23800576, 2829178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	23583981, 26829751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	28930752		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19615744, 27457538, 29666007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35136029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	15187020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	29317678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11552989, 16797705, 8195713, 9737692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	16461764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	22579713, 25849990, 27748374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22260379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10416595, 11034064, 1445802, 15750593, 1630821, 16783165, 20702610, 21062812, 21164292, 21572406, 21618541, 21853052, 21901247, 21976542, 2204478 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	22230766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10416595, 10655443, 12880987, 15650235, 30483774		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	2123747, 30483774, 3380093	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24486218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	29214365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17690249, 30971760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26768615, 35461324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	21237494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31570789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32878513, 34145334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26657649, 27246849, 27354262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23675407, 27354262, 31928012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	29533280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29760303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	29760303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21046410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19264517, 25849990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	19264517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17435759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29233926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17435759, 17934490, 18070937, 24424791, 25231743, 25394790, 26004809, 30599775, 30646895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	17435759, 28671688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	17976522, 25252869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24847116, 30863497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22431717, 36321189, 36410437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31066170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28973440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	25587024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	34176176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	8752671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	23698072, 28489605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	11675351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	11675351, 28209049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	31758945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	2578097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 11	Spinocerebellar ataxia	Pubtator	24667352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30370523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21931799, 25530421, 28078605, 32309437, 37752199, 37781029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	8752671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	33990643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	19696200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	25849990, 29047144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	25849990, 29047144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	38497387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26095796, 29149504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27491809, 28697743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36994664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28323779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36028854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MYB (MYB proto-oncogene, transcription factor)