Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	4601
Gene name	MAX interactor 1, dimerization protein
Gene symbol	MXI1
Synonyms (NCBI Gene)	MAD2MXD2MXIbHLHc11
Chromosome	10
Chromosome location	10q25.2
Summary	Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regu

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137852603	A>C	Pathogenic	Missense variant, coding sequence variant
rs137852604	C>T	Pathogenic	Missense variant, coding sequence variant
rs387906417	T>C	Pathogenic	Splice donor variant

347

Show/Hide all (347)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017857	hsa-miR-335-5p	Microarray	18185580
MIRT001748	hsa-miR-375	Other	15806104
MIRT020453	hsa-miR-106b-5p	Microarray	17242205
MIRT024480	hsa-miR-215-5p	Microarray	19074876
MIRT026461	hsa-miR-192-5p	Microarray	19074876
MIRT029559	hsa-miR-26b-5p	Microarray	19088304
MIRT047907	hsa-miR-30c-5p	CLASH	23622248
MIRT020453	hsa-miR-106b-5p	CLASH	23622248
MIRT040089	hsa-miR-615-3p	CLASH	23622248
MIRT039065	hsa-miR-769-3p	CLASH	23622248
MIRT053042	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	23254855
MIRT053042	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	23254855
MIRT053043	hsa-miR-27a-5p	Luciferase reporter assayqRT-PCRWestern blot	23254855
MIRT053043	hsa-miR-27a-5p	Luciferase reporter assayqRT-PCRWestern blot	23254855
MIRT053043	hsa-miR-27a-5p	Luciferase reporter assayqRT-PCRWestern blot	23254855
MIRT053043	hsa-miR-27a-5p	Luciferase reporter assayqRT-PCRWestern blot	23254855
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT438018	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24376632
MIRT642035	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT642034	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT642033	hsa-miR-4775	HITS-CLIP	23824327
MIRT443502	hsa-miR-302f	PAR-CLIP	23446348
MIRT443498	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT443497	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT522413	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT522412	hsa-miR-6086	PAR-CLIP	23446348
MIRT443495	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT522411	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT522410	hsa-miR-3689d	PAR-CLIP	23446348
MIRT522409	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT472715	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT472714	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT522408	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT443494	hsa-miR-1273e	PAR-CLIP	23446348
MIRT522407	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT446664	hsa-miR-548g-3p	PAR-CLIP	22291592
MIRT446663	hsa-miR-216b-3p	PAR-CLIP	22291592
MIRT446662	hsa-miR-342-3p	PAR-CLIP	22291592
MIRT446661	hsa-miR-676-5p	PAR-CLIP	22291592
MIRT446660	hsa-miR-6715b-3p	PAR-CLIP	22291592
MIRT443502	hsa-miR-302f	PAR-CLIP	23592263
MIRT443500	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT443501	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT443499	hsa-miR-940	PAR-CLIP	23592263
MIRT443498	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT443497	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT443496	hsa-miR-1827	PAR-CLIP	23592263
MIRT443495	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT472715	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT472714	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT443494	hsa-miR-1273e	PAR-CLIP	23592263
MIRT446664	hsa-miR-548g-3p	PAR-CLIP	22100165
MIRT446663	hsa-miR-216b-3p	PAR-CLIP	22100165
MIRT446662	hsa-miR-342-3p	PAR-CLIP	22100165
MIRT446661	hsa-miR-676-5p	PAR-CLIP	22100165
MIRT446660	hsa-miR-6715b-3p	PAR-CLIP	22100165
MIRT446664	hsa-miR-548g-3p	PAR-CLIP	22100165
MIRT446663	hsa-miR-216b-3p	PAR-CLIP	22100165
MIRT446662	hsa-miR-342-3p	PAR-CLIP	22100165
MIRT446661	hsa-miR-676-5p	PAR-CLIP	22100165
MIRT446660	hsa-miR-6715b-3p	PAR-CLIP	22100165
MIRT443502	hsa-miR-302f	PAR-CLIP	22100165
MIRT443500	hsa-miR-6808-5p	PAR-CLIP	22100165
MIRT443501	hsa-miR-6893-5p	PAR-CLIP	22100165
MIRT443499	hsa-miR-940	PAR-CLIP	22100165
MIRT443498	hsa-miR-4768-3p	PAR-CLIP	22100165
MIRT443497	hsa-miR-219b-3p	PAR-CLIP	22100165
MIRT443496	hsa-miR-1827	PAR-CLIP	22100165
MIRT443495	hsa-miR-4722-5p	PAR-CLIP	22100165
MIRT443494	hsa-miR-1273e	PAR-CLIP	22100165
MIRT020453	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440170	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT020453	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT727129	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727128	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT727127	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727126	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440170	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT522410	hsa-miR-3689d	PAR-CLIP	27292025
MIRT522413	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT522408	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT522412	hsa-miR-6086	PAR-CLIP	27292025
MIRT522411	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT522407	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT522409	hsa-miR-6851-5p	PAR-CLIP	27292025
MIRT472715	hsa-miR-6880-5p	PAR-CLIP	27292025
MIRT472714	hsa-miR-7847-3p	PAR-CLIP	27292025
MIRT020453	hsa-miR-106b-5p	qRT-PCR	33773548
MIRT642035	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT642034	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT642033	hsa-miR-4775	HITS-CLIP	23824327
MIRT443502	hsa-miR-302f	PAR-CLIP	23446348
MIRT443498	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT443497	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT522413	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT522412	hsa-miR-6086	PAR-CLIP	23446348
MIRT443495	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT522411	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT522410	hsa-miR-3689d	PAR-CLIP	23446348
MIRT522409	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT472715	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT472714	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT522408	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT443494	hsa-miR-1273e	PAR-CLIP	23446348
MIRT522407	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT446664	hsa-miR-548g-3p	PAR-CLIP	22291592
MIRT446663	hsa-miR-216b-3p	PAR-CLIP	22291592
MIRT446662	hsa-miR-342-3p	PAR-CLIP	22291592
MIRT446661	hsa-miR-676-5p	PAR-CLIP	22291592
MIRT446660	hsa-miR-6715b-3p	PAR-CLIP	22291592
MIRT443502	hsa-miR-302f	PAR-CLIP	23592263
MIRT443500	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT443501	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT443499	hsa-miR-940	PAR-CLIP	23592263
MIRT443498	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT443497	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT443496	hsa-miR-1827	PAR-CLIP	23592263
MIRT443495	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT472715	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT472714	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT443494	hsa-miR-1273e	PAR-CLIP	23592263
MIRT446664	hsa-miR-548g-3p	PAR-CLIP	22100165
MIRT446663	hsa-miR-216b-3p	PAR-CLIP	22100165
MIRT446662	hsa-miR-342-3p	PAR-CLIP	22100165
MIRT446661	hsa-miR-676-5p	PAR-CLIP	22100165
MIRT446660	hsa-miR-6715b-3p	PAR-CLIP	22100165
MIRT446664	hsa-miR-548g-3p	PAR-CLIP	22100165
MIRT446663	hsa-miR-216b-3p	PAR-CLIP	22100165
MIRT446662	hsa-miR-342-3p	PAR-CLIP	22100165
MIRT446661	hsa-miR-676-5p	PAR-CLIP	22100165
MIRT446660	hsa-miR-6715b-3p	PAR-CLIP	22100165
MIRT443502	hsa-miR-302f	PAR-CLIP	22100165
MIRT443500	hsa-miR-6808-5p	PAR-CLIP	22100165
MIRT443501	hsa-miR-6893-5p	PAR-CLIP	22100165
MIRT443499	hsa-miR-940	PAR-CLIP	22100165
MIRT443498	hsa-miR-4768-3p	PAR-CLIP	22100165
MIRT443497	hsa-miR-219b-3p	PAR-CLIP	22100165
MIRT443496	hsa-miR-1827	PAR-CLIP	22100165
MIRT443495	hsa-miR-4722-5p	PAR-CLIP	22100165
MIRT443494	hsa-miR-1273e	PAR-CLIP	22100165
MIRT1167059	hsa-miR-128	CLIP-seq
MIRT1167060	hsa-miR-1294	CLIP-seq
MIRT1167061	hsa-miR-1297	CLIP-seq
MIRT1167062	hsa-miR-2355-5p	CLIP-seq
MIRT1167063	hsa-miR-26a	CLIP-seq
MIRT1167064	hsa-miR-26b	CLIP-seq
MIRT1167065	hsa-miR-3121-3p	CLIP-seq
MIRT1167066	hsa-miR-3199	CLIP-seq
MIRT1167067	hsa-miR-320a	CLIP-seq
MIRT1167068	hsa-miR-320b	CLIP-seq
MIRT1167069	hsa-miR-320c	CLIP-seq
MIRT1167070	hsa-miR-320d	CLIP-seq
MIRT1167071	hsa-miR-3618	CLIP-seq
MIRT1167072	hsa-miR-3679-3p	CLIP-seq
MIRT1167073	hsa-miR-3915	CLIP-seq
MIRT1167074	hsa-miR-3928	CLIP-seq
MIRT1167075	hsa-miR-3974	CLIP-seq
MIRT1167076	hsa-miR-4316	CLIP-seq
MIRT1167077	hsa-miR-4429	CLIP-seq
MIRT1167078	hsa-miR-4446-5p	CLIP-seq
MIRT1167079	hsa-miR-4465	CLIP-seq
MIRT1167080	hsa-miR-4648	CLIP-seq
MIRT1167081	hsa-miR-4677-3p	CLIP-seq
MIRT1167082	hsa-miR-4711-3p	CLIP-seq
MIRT1167083	hsa-miR-4725-5p	CLIP-seq
MIRT1167084	hsa-miR-504	CLIP-seq
MIRT1167085	hsa-miR-555	CLIP-seq
MIRT1167086	hsa-miR-648	CLIP-seq
MIRT1167087	hsa-miR-934	CLIP-seq
MIRT1167059	hsa-miR-128	CLIP-seq
MIRT1167060	hsa-miR-1294	CLIP-seq
MIRT1167088	hsa-miR-185	CLIP-seq
MIRT1167089	hsa-miR-214	CLIP-seq
MIRT1167090	hsa-miR-2392	CLIP-seq
MIRT1167066	hsa-miR-3199	CLIP-seq
MIRT1167091	hsa-miR-3619-5p	CLIP-seq
MIRT1167073	hsa-miR-3915	CLIP-seq
MIRT1167074	hsa-miR-3928	CLIP-seq
MIRT1167092	hsa-miR-4306	CLIP-seq
MIRT1167076	hsa-miR-4316	CLIP-seq
MIRT1167093	hsa-miR-4436b-3p	CLIP-seq
MIRT1167094	hsa-miR-4493	CLIP-seq
MIRT1167095	hsa-miR-4528	CLIP-seq
MIRT1167096	hsa-miR-4534	CLIP-seq
MIRT1167097	hsa-miR-4539	CLIP-seq
MIRT1167098	hsa-miR-4644	CLIP-seq
MIRT1167080	hsa-miR-4648	CLIP-seq
MIRT1167081	hsa-miR-4677-3p	CLIP-seq
MIRT1167099	hsa-miR-4753-5p	CLIP-seq
MIRT1167100	hsa-miR-495	CLIP-seq
MIRT1167101	hsa-miR-580	CLIP-seq
MIRT1167086	hsa-miR-648	CLIP-seq
MIRT1167102	hsa-miR-761	CLIP-seq
MIRT1167061	hsa-miR-1297	CLIP-seq
MIRT1167063	hsa-miR-26a	CLIP-seq
MIRT1167064	hsa-miR-26b	CLIP-seq
MIRT2277181	hsa-miR-433	CLIP-seq
MIRT2277182	hsa-miR-4438	CLIP-seq
MIRT1167079	hsa-miR-4465	CLIP-seq
MIRT2277183	hsa-miR-4769-3p	CLIP-seq
MIRT2277184	hsa-miR-544	CLIP-seq
MIRT2277185	hsa-miR-548c-3p	CLIP-seq
MIRT2277186	hsa-miR-583	CLIP-seq
MIRT2391208	hsa-miR-1915	CLIP-seq
MIRT2391209	hsa-miR-2113	CLIP-seq
MIRT2391210	hsa-miR-3202	CLIP-seq
MIRT2391211	hsa-miR-4747-5p	CLIP-seq
MIRT1167100	hsa-miR-495	CLIP-seq
MIRT2391212	hsa-miR-570	CLIP-seq
MIRT2454642	hsa-miR-24	CLIP-seq
MIRT2454643	hsa-miR-3136-3p	CLIP-seq
MIRT2454644	hsa-miR-4284	CLIP-seq
MIRT2454645	hsa-miR-4474-3p	CLIP-seq
MIRT1167094	hsa-miR-4493	CLIP-seq
MIRT2277185	hsa-miR-548c-3p	CLIP-seq
MIRT2575987	hsa-miR-1245b-5p	CLIP-seq
MIRT2575988	hsa-miR-1269	CLIP-seq
MIRT2575989	hsa-miR-1269b	CLIP-seq
MIRT2575990	hsa-miR-1276	CLIP-seq
MIRT2575991	hsa-miR-1288	CLIP-seq
MIRT1167061	hsa-miR-1297	CLIP-seq
MIRT2575992	hsa-miR-1298	CLIP-seq
MIRT1167088	hsa-miR-185	CLIP-seq
MIRT2391208	hsa-miR-1915	CLIP-seq
MIRT2575993	hsa-miR-2052	CLIP-seq
MIRT1167089	hsa-miR-214	CLIP-seq
MIRT1167090	hsa-miR-2392	CLIP-seq
MIRT1167063	hsa-miR-26a	CLIP-seq
MIRT1167064	hsa-miR-26b	CLIP-seq
MIRT2575994	hsa-miR-29a	CLIP-seq
MIRT2575995	hsa-miR-29b	CLIP-seq
MIRT2575996	hsa-miR-29c	CLIP-seq
MIRT2575997	hsa-miR-3142	CLIP-seq
MIRT2575998	hsa-miR-3166	CLIP-seq
MIRT2575999	hsa-miR-328	CLIP-seq
MIRT1167091	hsa-miR-3619-5p	CLIP-seq
MIRT2576000	hsa-miR-3647-3p	CLIP-seq
MIRT2576001	hsa-miR-3655	CLIP-seq
MIRT2576002	hsa-miR-374c	CLIP-seq
MIRT2576003	hsa-miR-3929	CLIP-seq
MIRT2576004	hsa-miR-3942-5p	CLIP-seq
MIRT1167092	hsa-miR-4306	CLIP-seq
MIRT2576005	hsa-miR-4311	CLIP-seq
MIRT2576006	hsa-miR-4312	CLIP-seq
MIRT2576007	hsa-miR-4419b	CLIP-seq
MIRT1167093	hsa-miR-4436b-3p	CLIP-seq
MIRT1167079	hsa-miR-4465	CLIP-seq
MIRT2576008	hsa-miR-4478	CLIP-seq
MIRT2576009	hsa-miR-4515	CLIP-seq
MIRT1167095	hsa-miR-4528	CLIP-seq
MIRT1167096	hsa-miR-4534	CLIP-seq
MIRT2576010	hsa-miR-4633-3p	CLIP-seq
MIRT1167098	hsa-miR-4644	CLIP-seq
MIRT2576011	hsa-miR-4668-3p	CLIP-seq
MIRT2576012	hsa-miR-4682	CLIP-seq
MIRT2576013	hsa-miR-4703-5p	CLIP-seq
MIRT2576014	hsa-miR-4717-3p	CLIP-seq
MIRT1167083	hsa-miR-4725-5p	CLIP-seq
MIRT2576015	hsa-miR-4726-3p	CLIP-seq
MIRT2576016	hsa-miR-4740-5p	CLIP-seq
MIRT2576017	hsa-miR-4802-3p	CLIP-seq
MIRT2576018	hsa-miR-485-5p	CLIP-seq
MIRT1167084	hsa-miR-504	CLIP-seq
MIRT2576019	hsa-miR-511	CLIP-seq
MIRT2576020	hsa-miR-545	CLIP-seq
MIRT2576021	hsa-miR-578	CLIP-seq
MIRT2277186	hsa-miR-583	CLIP-seq
MIRT2576022	hsa-miR-633	CLIP-seq
MIRT2576023	hsa-miR-655	CLIP-seq
MIRT2576024	hsa-miR-663b	CLIP-seq
MIRT1167102	hsa-miR-761	CLIP-seq
MIRT2576025	hsa-miR-802	CLIP-seq
MIRT2576026	hsa-miR-885-5p	CLIP-seq
MIRT2685584	hsa-miR-106a	CLIP-seq
MIRT2685585	hsa-miR-106b	CLIP-seq
MIRT2575987	hsa-miR-1245b-5p	CLIP-seq
MIRT2575988	hsa-miR-1269	CLIP-seq
MIRT2575989	hsa-miR-1269b	CLIP-seq
MIRT2575990	hsa-miR-1276	CLIP-seq
MIRT1167059	hsa-miR-128	CLIP-seq
MIRT2575991	hsa-miR-1288	CLIP-seq
MIRT1167061	hsa-miR-1297	CLIP-seq
MIRT2575992	hsa-miR-1298	CLIP-seq
MIRT2685586	hsa-miR-17	CLIP-seq
MIRT2391208	hsa-miR-1915	CLIP-seq
MIRT2575993	hsa-miR-2052	CLIP-seq
MIRT2685587	hsa-miR-20a	CLIP-seq
MIRT2685588	hsa-miR-20b	CLIP-seq
MIRT1167089	hsa-miR-214	CLIP-seq
MIRT1167090	hsa-miR-2392	CLIP-seq
MIRT1167063	hsa-miR-26a	CLIP-seq
MIRT1167064	hsa-miR-26b	CLIP-seq
MIRT2575994	hsa-miR-29a	CLIP-seq
MIRT2575995	hsa-miR-29b	CLIP-seq
MIRT2575996	hsa-miR-29c	CLIP-seq
MIRT2575997	hsa-miR-3142	CLIP-seq
MIRT2575998	hsa-miR-3166	CLIP-seq
MIRT1167066	hsa-miR-3199	CLIP-seq
MIRT2575999	hsa-miR-328	CLIP-seq
MIRT1167091	hsa-miR-3619-5p	CLIP-seq
MIRT2576000	hsa-miR-3647-3p	CLIP-seq
MIRT2576001	hsa-miR-3655	CLIP-seq
MIRT2576002	hsa-miR-374c	CLIP-seq
MIRT2685589	hsa-miR-3913-3p	CLIP-seq
MIRT2576003	hsa-miR-3929	CLIP-seq
MIRT2685590	hsa-miR-3973	CLIP-seq
MIRT2576005	hsa-miR-4311	CLIP-seq
MIRT2576006	hsa-miR-4312	CLIP-seq
MIRT2576007	hsa-miR-4419b	CLIP-seq
MIRT1167093	hsa-miR-4436b-3p	CLIP-seq
MIRT1167079	hsa-miR-4465	CLIP-seq
MIRT2576008	hsa-miR-4478	CLIP-seq
MIRT2576009	hsa-miR-4515	CLIP-seq
MIRT1167095	hsa-miR-4528	CLIP-seq
MIRT2576010	hsa-miR-4633-3p	CLIP-seq
MIRT1167080	hsa-miR-4648	CLIP-seq
MIRT2576012	hsa-miR-4682	CLIP-seq
MIRT2576014	hsa-miR-4717-3p	CLIP-seq
MIRT1167083	hsa-miR-4725-5p	CLIP-seq
MIRT2576015	hsa-miR-4726-3p	CLIP-seq
MIRT2576016	hsa-miR-4740-5p	CLIP-seq
MIRT2576017	hsa-miR-4802-3p	CLIP-seq
MIRT2576018	hsa-miR-485-5p	CLIP-seq
MIRT2685591	hsa-miR-489	CLIP-seq
MIRT1167084	hsa-miR-504	CLIP-seq
MIRT2576019	hsa-miR-511	CLIP-seq
MIRT2685592	hsa-miR-513a-3p	CLIP-seq
MIRT2685593	hsa-miR-519a	CLIP-seq
MIRT2685594	hsa-miR-519b-3p	CLIP-seq
MIRT2685595	hsa-miR-519c-3p	CLIP-seq
MIRT2685596	hsa-miR-519d	CLIP-seq
MIRT2685597	hsa-miR-520g	CLIP-seq
MIRT2685598	hsa-miR-520h	CLIP-seq
MIRT2576021	hsa-miR-578	CLIP-seq
MIRT2277186	hsa-miR-583	CLIP-seq
MIRT2576022	hsa-miR-633	CLIP-seq
MIRT2576023	hsa-miR-655	CLIP-seq
MIRT2576024	hsa-miR-663b	CLIP-seq
MIRT1167102	hsa-miR-761	CLIP-seq
MIRT2576025	hsa-miR-802	CLIP-seq
MIRT2685599	hsa-miR-93	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYCN	Repression	24403858

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11875718
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	8425219
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11875718
GO:0001825	Process	Blastocyst formation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9184233, 16189514, 25416956, 25609649, 26871637, 27705803, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8425219
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	8425219

MIM	HGNC	e!Ensembl
600020	7534	ENSG00000119950

P50539

Protein name

Max-interacting protein 1 (Max interactor 1) (Class C basic helix-loop-helix protein 11) (bHLHc11)

Protein function

Transcriptional repressor. MXI1 binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. MXI1 thus antagonizes MYC transcriptional activity by competing for MAX.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	68 → 120	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High levels found in the brain, heart and lung while lower levels are seen in the liver, kidney and skeletal muscle.

Sequence

MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSG
SSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLE
EAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVD
VESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS

Sequence length

228

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurofibrosarcoma	Pathogenic	rs137852604	RCV000010145	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian cancer	Likely pathogenic	rs1564709391	RCV003154800	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate cancer	Pathogenic	rs2496871974, rs387906417, rs137852603	RCV000010142 RCV000010143 RCV000010144	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MXI1-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (102)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	17577784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15013707, 15457580, 18699967, 21376419, 8603382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	10229497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	9458379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27077767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17102621, 22706201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10229497		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19174606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15013707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11351349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11058880, 23995871, 27664031, 31396344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24376632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	9354456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26943585, 27292643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11875718, 19018165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23995871, 7829091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11058880, 23995871, 27664031, 31396344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21376419, 26980454, 28176922, 29507620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19018165	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22069160, 24609542, 29465507, 30814209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17102621, 22706201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084, 7829091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21377782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15457580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24491803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	17350592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	32873880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19239430, 27077767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22069160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10849326, 19558549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10849326, 19558549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	27315568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11875718, 15548375, 22706201, 24376632, 26943771, 7789959, 9354456, 9499454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	11875718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11875718, 24376632, 26943771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11875718, 22706201, 24376632, 26943771, 9354456, 9499454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24376632, 29408509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24376632	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37934565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18087215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	21472690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	23316056		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	19018165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25754611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	18477210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17934339, 18715617, 28065785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11201745, 22992948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29507620, 35149174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35501353	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30601084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	7789959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11390010, 26943585, 27292643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10849326, 19558549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21376419, 26980454, 28176922, 29507620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25754611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24609542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11351349, 7773287, 8827088, 9376279, 9458379, 9669667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	UNIPROT_DG	7773287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16112690, 20440596, 25483095, 30448220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23995871, 27664031, 31396344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16760651, 17044027, 17222786, 17577784, 18715617, 19935801, 20034488, 20440596, 21376419, 21901524, 22992948, 23093575, 23128250, 24425774, 27315568 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	10470286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	19174606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17102621, 22706201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	17102621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23291781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14559981, 21912348		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14559981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Dermatofibrosarcoma Protuberans	Metastatic Dermatofibrosarcoma Protuberans	BEFREE	18477210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	20643875		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25637637, 29220700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11133821, 15735033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10229497, 10470286, 10849326, 11058880, 11401316, 11875718, 14559981, 15254432, 15306814, 15457580, 15548375, 16402339, 16885739, 17189715, 17259655 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19254710, 24403858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24403858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	BEFREE	10470286		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	10470286	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurofibrosarcoma	Neurofibrosarcoma	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21376419, 25256346, 27697601, 30346937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21901524, 22992948, 29234590		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24609542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	22797604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	17350592, 19637234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	7773287, 9376279, 9458379, 9669667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	11351349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	11351349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11351349, 7585509, 7773287, 9354456, 9376279, 9669667		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11351349, 24713434, 32784653, 33279858, 39287260	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinoblastoma	Retinoblastoma	BEFREE	15306814, 28176922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	18477210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	17559306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30346937, 9796705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25503128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16885739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16112690, 20440596, 25483095, 30448220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11181568, 17322345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23995871		★★★★★ ★☆☆☆☆ Found in Text Mining only

MXI1 (MAX interactor 1, dimerization protein)