Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4599
Gene name	MX dynamin like GTPase 1
Gene symbol	MX1
Synonyms (NCBI Gene)	IFI-78KIFI78MXMxAlncMX1-215
Chromosome	21
Chromosome location	21q22.3
Summary	This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA a

174

Show/Hide all (174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT734368	hsa-miR-221-3p	ELISALuciferase reporter assayRNA-seqWestern blotting	32209695
MIRT734369	hsa-miR-125b-5p	ELISALuciferase reporter assayRNA-seqWestern blotting	32209695
MIRT2575804	hsa-miR-1292	CLIP-seq
MIRT2575805	hsa-miR-1324	CLIP-seq
MIRT2575806	hsa-miR-141	CLIP-seq
MIRT2575807	hsa-miR-1825	CLIP-seq
MIRT2575808	hsa-miR-188-5p	CLIP-seq
MIRT2575809	hsa-miR-191	CLIP-seq
MIRT2575810	hsa-miR-1910	CLIP-seq
MIRT2575811	hsa-miR-197	CLIP-seq
MIRT2575812	hsa-miR-199a-5p	CLIP-seq
MIRT2575813	hsa-miR-199b-5p	CLIP-seq
MIRT2575814	hsa-miR-200a	CLIP-seq
MIRT2575815	hsa-miR-204	CLIP-seq
MIRT2575816	hsa-miR-205	CLIP-seq
MIRT2575817	hsa-miR-210	CLIP-seq
MIRT2575818	hsa-miR-211	CLIP-seq
MIRT2575819	hsa-miR-223	CLIP-seq
MIRT2575820	hsa-miR-2276	CLIP-seq
MIRT2575821	hsa-miR-3074-5p	CLIP-seq
MIRT2575822	hsa-miR-3120-5p	CLIP-seq
MIRT2575823	hsa-miR-3146	CLIP-seq
MIRT2575824	hsa-miR-3151	CLIP-seq
MIRT2575825	hsa-miR-3154	CLIP-seq
MIRT2575826	hsa-miR-3163	CLIP-seq
MIRT2575827	hsa-miR-3166	CLIP-seq
MIRT2575828	hsa-miR-3175	CLIP-seq
MIRT2575829	hsa-miR-3179	CLIP-seq
MIRT2575830	hsa-miR-3200-5p	CLIP-seq
MIRT2575831	hsa-miR-320e	CLIP-seq
MIRT2575832	hsa-miR-340	CLIP-seq
MIRT2575833	hsa-miR-342-3p	CLIP-seq
MIRT2575834	hsa-miR-345	CLIP-seq
MIRT2575835	hsa-miR-3607-5p	CLIP-seq
MIRT2575836	hsa-miR-3611	CLIP-seq
MIRT2575837	hsa-miR-3616-3p	CLIP-seq
MIRT2575838	hsa-miR-3647-3p	CLIP-seq
MIRT2575839	hsa-miR-3662	CLIP-seq
MIRT2575840	hsa-miR-3663-3p	CLIP-seq
MIRT2575841	hsa-miR-370	CLIP-seq
MIRT2575842	hsa-miR-3915	CLIP-seq
MIRT2575843	hsa-miR-3919	CLIP-seq
MIRT2575844	hsa-miR-3928	CLIP-seq
MIRT2575845	hsa-miR-4258	CLIP-seq
MIRT2575846	hsa-miR-4267	CLIP-seq
MIRT2575847	hsa-miR-4268	CLIP-seq
MIRT2575848	hsa-miR-4283	CLIP-seq
MIRT2575849	hsa-miR-4291	CLIP-seq
MIRT2575850	hsa-miR-4302	CLIP-seq
MIRT2575851	hsa-miR-4303	CLIP-seq
MIRT2575852	hsa-miR-4310	CLIP-seq
MIRT2575853	hsa-miR-4328	CLIP-seq
MIRT2575854	hsa-miR-4446-3p	CLIP-seq
MIRT2575855	hsa-miR-4448	CLIP-seq
MIRT2575856	hsa-miR-4475	CLIP-seq
MIRT2575857	hsa-miR-4489	CLIP-seq
MIRT2575858	hsa-miR-4492	CLIP-seq
MIRT2575859	hsa-miR-4498	CLIP-seq
MIRT2575860	hsa-miR-4508	CLIP-seq
MIRT2575861	hsa-miR-4528	CLIP-seq
MIRT2575862	hsa-miR-455-3p	CLIP-seq
MIRT2575863	hsa-miR-4649-3p	CLIP-seq
MIRT2575864	hsa-miR-4656	CLIP-seq
MIRT2575865	hsa-miR-4668-3p	CLIP-seq
MIRT2575866	hsa-miR-4679	CLIP-seq
MIRT2575867	hsa-miR-4697-3p	CLIP-seq
MIRT2575868	hsa-miR-4708-3p	CLIP-seq
MIRT2575869	hsa-miR-4712-5p	CLIP-seq
MIRT2575870	hsa-miR-4721	CLIP-seq
MIRT2575871	hsa-miR-4761-5p	CLIP-seq
MIRT2575872	hsa-miR-4797-5p	CLIP-seq
MIRT2575873	hsa-miR-486-3p	CLIP-seq
MIRT2575874	hsa-miR-516a-3p	CLIP-seq
MIRT2575875	hsa-miR-548c-3p	CLIP-seq
MIRT2575876	hsa-miR-558	CLIP-seq
MIRT2575877	hsa-miR-592	CLIP-seq
MIRT2575878	hsa-miR-597	CLIP-seq
MIRT2575879	hsa-miR-605	CLIP-seq
MIRT2575880	hsa-miR-622	CLIP-seq
MIRT2575881	hsa-miR-629	CLIP-seq
MIRT2575882	hsa-miR-648	CLIP-seq
MIRT2575883	hsa-miR-758	CLIP-seq
MIRT2575884	hsa-miR-760	CLIP-seq
MIRT2575885	hsa-miR-762	CLIP-seq
MIRT2575886	hsa-miR-770-5p	CLIP-seq
MIRT2575887	hsa-miR-941	CLIP-seq
MIRT2575804	hsa-miR-1292	CLIP-seq
MIRT2575805	hsa-miR-1324	CLIP-seq
MIRT2575806	hsa-miR-141	CLIP-seq
MIRT2575807	hsa-miR-1825	CLIP-seq
MIRT2575808	hsa-miR-188-5p	CLIP-seq
MIRT2575809	hsa-miR-191	CLIP-seq
MIRT2575810	hsa-miR-1910	CLIP-seq
MIRT2575811	hsa-miR-197	CLIP-seq
MIRT2575812	hsa-miR-199a-5p	CLIP-seq
MIRT2575813	hsa-miR-199b-5p	CLIP-seq
MIRT2575814	hsa-miR-200a	CLIP-seq
MIRT2575815	hsa-miR-204	CLIP-seq
MIRT2575816	hsa-miR-205	CLIP-seq
MIRT2575817	hsa-miR-210	CLIP-seq
MIRT2575818	hsa-miR-211	CLIP-seq
MIRT2575819	hsa-miR-223	CLIP-seq
MIRT2575820	hsa-miR-2276	CLIP-seq
MIRT2575821	hsa-miR-3074-5p	CLIP-seq
MIRT2575822	hsa-miR-3120-5p	CLIP-seq
MIRT2575823	hsa-miR-3146	CLIP-seq
MIRT2575824	hsa-miR-3151	CLIP-seq
MIRT2575825	hsa-miR-3154	CLIP-seq
MIRT2575826	hsa-miR-3163	CLIP-seq
MIRT2575827	hsa-miR-3166	CLIP-seq
MIRT2575828	hsa-miR-3175	CLIP-seq
MIRT2575829	hsa-miR-3179	CLIP-seq
MIRT2575830	hsa-miR-3200-5p	CLIP-seq
MIRT2575831	hsa-miR-320e	CLIP-seq
MIRT2575832	hsa-miR-340	CLIP-seq
MIRT2575833	hsa-miR-342-3p	CLIP-seq
MIRT2575834	hsa-miR-345	CLIP-seq
MIRT2575835	hsa-miR-3607-5p	CLIP-seq
MIRT2575836	hsa-miR-3611	CLIP-seq
MIRT2575837	hsa-miR-3616-3p	CLIP-seq
MIRT2575838	hsa-miR-3647-3p	CLIP-seq
MIRT2685562	hsa-miR-3652	CLIP-seq
MIRT2575839	hsa-miR-3662	CLIP-seq
MIRT2575840	hsa-miR-3663-3p	CLIP-seq
MIRT2575841	hsa-miR-370	CLIP-seq
MIRT2575842	hsa-miR-3915	CLIP-seq
MIRT2575843	hsa-miR-3919	CLIP-seq
MIRT2575844	hsa-miR-3928	CLIP-seq
MIRT2575845	hsa-miR-4258	CLIP-seq
MIRT2575846	hsa-miR-4267	CLIP-seq
MIRT2575847	hsa-miR-4268	CLIP-seq
MIRT2575848	hsa-miR-4283	CLIP-seq
MIRT2575849	hsa-miR-4291	CLIP-seq
MIRT2575850	hsa-miR-4302	CLIP-seq
MIRT2575851	hsa-miR-4303	CLIP-seq
MIRT2575852	hsa-miR-4310	CLIP-seq
MIRT2575853	hsa-miR-4328	CLIP-seq
MIRT2685563	hsa-miR-4430	CLIP-seq
MIRT2575854	hsa-miR-4446-3p	CLIP-seq
MIRT2575855	hsa-miR-4448	CLIP-seq
MIRT2575856	hsa-miR-4475	CLIP-seq
MIRT2575857	hsa-miR-4489	CLIP-seq
MIRT2575858	hsa-miR-4492	CLIP-seq
MIRT2575859	hsa-miR-4498	CLIP-seq
MIRT2575860	hsa-miR-4508	CLIP-seq
MIRT2685564	hsa-miR-4520a-3p	CLIP-seq
MIRT2575861	hsa-miR-4528	CLIP-seq
MIRT2575862	hsa-miR-455-3p	CLIP-seq
MIRT2685565	hsa-miR-4638-3p	CLIP-seq
MIRT2575863	hsa-miR-4649-3p	CLIP-seq
MIRT2575864	hsa-miR-4656	CLIP-seq
MIRT2575865	hsa-miR-4668-3p	CLIP-seq
MIRT2575866	hsa-miR-4679	CLIP-seq
MIRT2575867	hsa-miR-4697-3p	CLIP-seq
MIRT2575868	hsa-miR-4708-3p	CLIP-seq
MIRT2575869	hsa-miR-4712-5p	CLIP-seq
MIRT2575870	hsa-miR-4721	CLIP-seq
MIRT2575871	hsa-miR-4761-5p	CLIP-seq
MIRT2575872	hsa-miR-4797-5p	CLIP-seq
MIRT2575873	hsa-miR-486-3p	CLIP-seq
MIRT2575874	hsa-miR-516a-3p	CLIP-seq
MIRT2575875	hsa-miR-548c-3p	CLIP-seq
MIRT2575876	hsa-miR-558	CLIP-seq
MIRT2575877	hsa-miR-592	CLIP-seq
MIRT2575878	hsa-miR-597	CLIP-seq
MIRT2575879	hsa-miR-605	CLIP-seq
MIRT2575880	hsa-miR-622	CLIP-seq
MIRT2575881	hsa-miR-629	CLIP-seq
MIRT2575882	hsa-miR-648	CLIP-seq
MIRT2575883	hsa-miR-758	CLIP-seq
MIRT2575884	hsa-miR-760	CLIP-seq
MIRT2575885	hsa-miR-762	CLIP-seq
MIRT2575886	hsa-miR-770-5p	CLIP-seq
MIRT2575887	hsa-miR-941	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CREB5	Activation	21132541

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	15047845, 15757897, 21859714, 25416956, 28514442, 30833792, 32296183, 33961781
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	TAS	2154602
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21859714
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	HDA	16780588
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0006915	Process	Apoptotic process	TAS	9389754
GO:0006952	Process	Defense response	TAS	2154602
GO:0007165	Process	Signal transduction	TAS	9389754
GO:0008017	Function	Microtubule binding	IBA
GO:0009615	Process	Response to virus	IMP	15047845
GO:0016020	Component	Membrane	IEA
GO:0016185	Process	Synaptic vesicle budding from presynaptic endocytic zone membrane	IBA
GO:0031965	Component	Nuclear membrane	IDA
GO:0034340	Process	Response to type I interferon	TAS	21859714
GO:0042802	Function	Identical protein binding	IPI	20428112, 25295396, 25416956, 32296183
GO:0045071	Process	Negative regulation of viral genome replication	IDA	14687945, 15047845, 16202617
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	TAS	16202617
GO:0045202	Component	Synapse	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15047845
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0051607	Process	Defense response to virus	IEA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IEP	32270034
GO:0098793	Component	Presynapse	IEA
GO:0140374	Process	Antiviral innate immune response	IEP	25930096

MIM	HGNC	e!Ensembl
147150	7532	ENSG00000157601

P20591

Protein name

Interferon-induced GTP-binding protein Mx1 (Interferon-induced protein p78) (IFI-78K) (Interferon-regulated resistance GTP-binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) [Cleaved into: Interferon-induced GTP-binding pr

Protein function

Interferon-induced dynamin-like GTPase with antiviral activity against a wide range of RNA viruses and some DNA viruses. Its target viruses include negative-stranded RNA viruses and HBV through binding and inactivation of their ribonucleocapsid.

PDB

3LJB , 3SZR , 3ZYS , 4P4S , 4P4T , 4P4U , 5GTM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00350	Dynamin_N	73 → 249	Dynamin family	Domain
PF01031	Dynamin_M	260 → 547	Dynamin central region	Family
PF02212	GED	569 → 660	Dynamin GTPase effector domain	Family

Sequence

MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG

Sequence length

662

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 Hepatitis C Measles Influenza A Human papillomavirus infection Coronavirus disease - COVID-19		ISG15 antiviral mechanism Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (98)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	24674141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	10942113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	10942113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisynthetase syndrome	Antithrombin deficiency	Pubtator	34905301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	25809693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27356888, 29973208, 36524113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26399222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29379035, 7542578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	LHGDN	16769349, 17075576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	17075576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27456948, 32350677, 34942685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23246628, 27533247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	19332114	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27344170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Choledochal Cyst	LHGDN	17075576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Cholecystolithiasis	Pubtator	17075576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24771638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Cold	Common cold	Pubtator	10534191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	7542578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	19145458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33780352	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	32954523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	16859997, 17763410, 20506305, 29770465, 32954523, 33305541, 34873015, 34905301, 37353938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	24674141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	16859997, 29770465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36553678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10207158, 33933170, 38066591, 38095646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10942113, 7551417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	32954523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	39285636	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	CTD_human_DG	9389754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	19177264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	37398666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28475775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31518750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	30280423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20019841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	10207158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36071497	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	26115415, 37334926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	28046052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12680691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	19145458		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29189089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22950423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	17526009	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	26115415, 28139728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28139728	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure Acute	Liver failure	Pubtator	33376138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11154232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	34081040, 35356994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16947629, 22036215, 22859983, 23623029, 27412348, 28085900, 30280423, 31791398, 35967341, 36524113, 7542578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26175399	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22859983, 26815367, 29189089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	24674141, 25889472, 29189089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36532018, 37334926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24771638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23438650, 25327819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26411585		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31646109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38239354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31646109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	17188754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	31440254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16077073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16459719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16843495, 17126411, 17188754, 21886806, 28386647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21886806, 25396411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	28417621	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	Pubtator	40114239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22534638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	22531919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23438650, 25327819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17280610, 23438650, 25327819, 32640729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	29271328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	20555352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27418822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29387065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33253099, 40341181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	22950423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15766558, 16824203, 20462354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	LHGDN	15766558, 16824203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	23831963, 26857698, 33769968, 34349764, 35958619, 40341181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	31791398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29947075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20019841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	LHGDN	18843779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	10497108	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	38199847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular stomatitis	Pubtator	27170750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	8727077		★★★★★ ★☆☆☆☆ Found in Text Mining only

MX1 (MX dynamin like GTPase 1)