Gene Gene information from NCBI Gene database.
Entrez ID 4598
Gene name Mevalonate kinase
Gene symbol MVK
Synonyms (NCBI Gene)
LRBPMKMVLKPOROK3
Chromosome 12
Chromosome location 12q24.11
Summary This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic a
SNPs SNP information provided by dbSNP.
37
SNP ID Visualize variation Clinical significance Consequence
rs28934897 G>A Pathogenic, uncertain-significance Missense variant, genic downstream transcript variant, coding sequence variant
rs72648042 C>T Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, synonymous variant, coding sequence variant
rs76914224 G>A Conflicting-interpretations-of-pathogenicity, likely-benign, not-provided Coding sequence variant, missense variant
rs104895298 G>A Pathogenic, not-provided Coding sequence variant, intron variant, missense variant
rs104895300 C>T Pathogenic, likely-pathogenic Coding sequence variant, intron variant, missense variant
miRNA miRNA information provided by mirtarbase database.
266
miRTarBase ID miRNA Experiments Reference
MIRT022207 hsa-miR-124-3p Microarray 18668037
MIRT724892 hsa-miR-4519 HITS-CLIP 19536157
MIRT724891 hsa-miR-4530 HITS-CLIP 19536157
MIRT724890 hsa-miR-338-3p HITS-CLIP 19536157
MIRT724889 hsa-miR-766-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000287 Function Magnesium ion binding ISS
GO:0004496 Function Mevalonate kinase activity IBA
GO:0004496 Function Mevalonate kinase activity IDA 1377680, 9325256, 14680974, 14730012, 18302342
GO:0004496 Function Mevalonate kinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
251170 7530 ENSG00000110921
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q03426
Protein name Mevalonate kinase (MK) (EC 2.7.1.36)
Protein function Catalyzes the phosphorylation of mevalonate to mevalonate 5-phosphate, a key step in isoprenoid and cholesterol biosynthesis (PubMed:11278915, PubMed:18302342, PubMed:9325256, PubMed:9392419). {ECO:0000269|PubMed:11278915, ECO:0000269|PubMed:183
PDB 2R3V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00288 GHMP_kinases_N 130 212 GHMP kinases N terminal domain Family
PF08544 GHMP_kinases_C 289 366 GHMP kinases C terminal Family
Sequence
MLSEVLLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKR
AWDVARLQSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSIC
RKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTVCEEIPNPLKDGDCVNRWTKE
DLELINKWAFQGERMIHGNPSGVDNAVSTWGG
ALRYHQGKISSLKRSPALQILLTNTKVP
RNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLEELIDM
NQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQAL
TSCGFD
CLETSIGAPGVSIHSATSLDSRVQQALDGL
Sequence length 396
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
  Cholesterol biosynthesis
Activation of gene expression by SREBF (SREBP)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
47
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autoinflammatory syndrome Pathogenic; Likely pathogenic rs104895311, rs104895364, rs104895352, rs1566150887, rs28934897, rs104895304, rs104895319 RCV002262661
RCV002262662
RCV002262665
RCV002262076
RCV002262563
View all (2 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
autosomal recessive MVK-related disorders Likely pathogenic; Pathogenic rs28934897 RCV006439567
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cervical cancer Pathogenic rs398122910 RCV005888872
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deficiency of mevalonate kinase Likely pathogenic; Pathogenic rs104895324, rs104895332, rs104895305, rs104895362, rs104895373 RCV005632234
RCV005632235
RCV005632236
RCV005636844
RCV005632193
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTHRALGIA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Actinic porokeratosis Porokeratosis GENOMICS_ENGLAND_DG 24781643
★☆☆☆☆
Found in Text Mining only
alpha 1-Antitrypsin Deficiency Alpha 1-Antitrypsin Deficiency BEFREE 31430439
★☆☆☆☆
Found in Text Mining only
Anemia of inadequate production Anemia BEFREE 20194276
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis HPO_DG
★☆☆☆☆
Found in Text Mining only
Autoinflammatory disorder Autoinflammatory Disease BEFREE 12861380, 16802371, 20814828, 30652926
★☆☆☆☆
Found in Text Mining only
Autoinflammatory disorder Autoinflammatory Disease GENOMICS_ENGLAND_DG 16435210
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet Syndrome BEFREE 17213252, 24411001
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet disease Pubtator 17213252, 28814775, 30808881 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 7747441 Associate
★☆☆☆☆
Found in Text Mining only
Cataract Cataract HPO_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations