Gene Gene information from NCBI Gene database.
Entrez ID 4595
Gene name MutY DNA glycosylase
Gene symbol MUTYH
Synonyms (NCBI Gene)
MYH
Chromosome 1
Chromosome location 1p34.1
Summary This gene encodes a DNA glycosylase involved in oxidative DNA damage repair. The enzyme excises adenine bases from the DNA backbone at sites where adenine is inappropriately paired with guanine, cytosine, or 8-oxo-7,8-dihydroguanine, a major oxidatively d
SNPs SNP information provided by dbSNP.
201
SNP ID Visualize variation Clinical significance Consequence
rs3219488 G>A Likely-benign, conflicting-interpretations-of-pathogenicity Intron variant
rs34126013 G>A Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
rs34612342 T>C Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs35352891 G>A Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, missense variant, non coding transcript variant
rs36053993 C>A,T Pathogenic, uncertain-significance, pathogenic-likely-pathogenic, likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
10
miRTarBase ID miRNA Experiments Reference
MIRT640343 hsa-miR-4637 HITS-CLIP 23824327
MIRT640342 hsa-miR-3664-3p HITS-CLIP 23824327
MIRT640341 hsa-miR-1266-5p HITS-CLIP 23824327
MIRT640340 hsa-miR-4518 HITS-CLIP 23824327
MIRT640339 hsa-miR-4320 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000701 Function Purine-specific mismatch base pair DNA N-glycosylase activity IBA
GO:0000701 Function Purine-specific mismatch base pair DNA N-glycosylase activity IEA
GO:0000701 Function Purine-specific mismatch base pair DNA N-glycosylase activity IMP 20848659
GO:0003677 Function DNA binding IEA
GO:0003824 Function Catalytic activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604933 7527 ENSG00000132781
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UIF7
Protein name Adenine DNA glycosylase (EC 3.2.2.31) (MutY homolog) (hMYH)
Protein function Involved in oxidative DNA damage repair. Initiates repair of A*oxoG to C*G by removing the inappropriately paired adenine base from the DNA backbone. Possesses both adenine and 2-OH-A DNA glycosylase activities. {ECO:0000269|PubMed:10684930, ECO
PDB 1X51 , 3N5N , 8FAY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00730 HhH-GPD 129 265 HhH-GPD superfamily base excision DNA repair protein Domain
PF00633 HHH 193 223 Helix-hairpin-helix motif Motif
PF14815 NUDIX_4 370 493 NUDIX domain Domain
Sequence
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGMIAECPG
APAGLARQPEEVVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDL
DRRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRG
RRLQEGARKVVE
ELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVL
CRVRAIGADPSSTLVSQQLWGLAQQ
LVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVE
SLCRARQRVEQEQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKAS
RKPPREESSATCVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQE
LQRWAGPLPATHLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHT
AAVSTAMKKVFRV
YQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHS
LNSAAQ
Sequence length 546
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Base excision repair   Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Displacement of DNA glycosylase by APEX1
Defective MUTYH substrate binding
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
57
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
B lymphoblastic leukemia lymphoma, no ICD-O subtype Pathogenic rs529008617 RCV000722033
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Breast carcinoma Likely pathogenic; Pathogenic rs587778541, rs140342925, rs587783057, rs374950566, rs36053993, rs1645259682 RCV001554326
RCV001262379
RCV001572626
RCV001554252
RCV001574076
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Carcinoma of colon Likely pathogenic; Pathogenic rs587780078, rs587780088, rs587778536, rs587780751, rs140342925, rs587781628, rs529008617, rs587782885, rs587783057, rs374950566, rs765123255, rs34612342, rs36053993, rs121908380, rs121908381
View all (4 more)
RCV000144636
RCV000144639
RCV000144632
RCV001353438
RCV001353906
View all (14 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Clear cell carcinoma of kidney Likely pathogenic; Pathogenic rs587782228 RCV005893699
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMATOUS POLYPOSIS, AUTOSOMAL RECESSIVE CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma LHGDN 18186383
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 19161591, 28390865
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon HPO_DG
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer CGI_DG
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 29209987
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of prostate Prostate adenocarcinoma BEFREE 27253753
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma LHGDN 12393807, 14999774, 15290654, 15890374, 16521226, 16831587, 16938257, 17219385, 17252231
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 12606733, 12707038, 12937124, 14735163, 15188161, 15449173, 15947872, 16287072, 16645203, 16890597, 16941501, 16943222, 17219385, 17931073, 17949294
View all (6 more)
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 12393807, 12606733, 12937124, 14579148, 14691304, 14991577, 14999774, 15034862, 15083190, 15180946, 15366000, 15465463, 15673720, 15890374, 15943555
View all (31 more)
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 12606733, 12628248, 14735163, 14999774, 15108288, 15188161, 15236166, 15366000, 15449173, 15478312, 15761860, 16103460, 16134146, 16134147, 16253015
View all (64 more)
★☆☆☆☆
Found in Text Mining only