MUC6 (mucin 6, oligomeric mucus/gel-forming (gene/pseudogene))

Gene

• Entrez ID: 4588
• Gene name: Mucin 6, oligomeric mucus/gel-forming (gene/pseudogene)
• Gene symbol: MUC6
• Synonyms (NCBI Gene): MUC-6
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. [pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018331	hsa-miR-335-5p	Microarray	18185580
MIRT1166376	hsa-miR-125a-5p	CLIP-seq
MIRT1166377	hsa-miR-125b	CLIP-seq
MIRT1166378	hsa-miR-1285	CLIP-seq
MIRT1166379	hsa-miR-1913	CLIP-seq
MIRT1166380	hsa-miR-214	CLIP-seq
MIRT1166381	hsa-miR-296-5p	CLIP-seq
MIRT1166382	hsa-miR-3187-5p	CLIP-seq
MIRT1166383	hsa-miR-324-3p	CLIP-seq
MIRT1166384	hsa-miR-326	CLIP-seq
MIRT1166385	hsa-miR-330-5p	CLIP-seq
MIRT1166386	hsa-miR-345	CLIP-seq
MIRT1166387	hsa-miR-3619-5p	CLIP-seq
MIRT1166388	hsa-miR-378g	CLIP-seq
MIRT1166389	hsa-miR-4290	CLIP-seq
MIRT1166390	hsa-miR-4314	CLIP-seq
MIRT1166391	hsa-miR-4319	CLIP-seq
MIRT1166392	hsa-miR-4438	CLIP-seq
MIRT1166393	hsa-miR-4446-3p	CLIP-seq
MIRT1166394	hsa-miR-4450	CLIP-seq
MIRT1166395	hsa-miR-4455	CLIP-seq
MIRT1166396	hsa-miR-4486	CLIP-seq
MIRT1166397	hsa-miR-4492	CLIP-seq
MIRT1166398	hsa-miR-4498	CLIP-seq
MIRT1166399	hsa-miR-4505	CLIP-seq
MIRT1166400	hsa-miR-4522	CLIP-seq
MIRT1166401	hsa-miR-4530	CLIP-seq
MIRT1166402	hsa-miR-4667-5p	CLIP-seq
MIRT1166403	hsa-miR-4700-5p	CLIP-seq
MIRT1166404	hsa-miR-4731-5p	CLIP-seq
MIRT1166405	hsa-miR-4732-3p	CLIP-seq
MIRT1166406	hsa-miR-609	CLIP-seq
MIRT1166407	hsa-miR-612	CLIP-seq
MIRT1166408	hsa-miR-670	CLIP-seq
MIRT1166409	hsa-miR-761	CLIP-seq
MIRT1166410	hsa-miR-762	CLIP-seq
MIRT1166389	hsa-miR-4290	CLIP-seq
MIRT2276800	hsa-miR-1184	CLIP-seq
MIRT2276801	hsa-miR-1205	CLIP-seq
MIRT2276802	hsa-miR-1207-5p	CLIP-seq
MIRT2276803	hsa-miR-1237	CLIP-seq
MIRT2276804	hsa-miR-1254	CLIP-seq
MIRT2276805	hsa-miR-1293	CLIP-seq
MIRT2276806	hsa-miR-138	CLIP-seq
MIRT2276807	hsa-miR-146b-3p	CLIP-seq
MIRT2276808	hsa-miR-150	CLIP-seq
MIRT2276809	hsa-miR-184	CLIP-seq
MIRT2276810	hsa-miR-1909	CLIP-seq
MIRT2276811	hsa-miR-1910	CLIP-seq
MIRT2276812	hsa-miR-205	CLIP-seq
MIRT2276813	hsa-miR-2278	CLIP-seq
MIRT2276814	hsa-miR-3074-5p	CLIP-seq
MIRT2276815	hsa-miR-3116	CLIP-seq
MIRT2276816	hsa-miR-3120-5p	CLIP-seq
MIRT2276817	hsa-miR-3157-5p	CLIP-seq
MIRT2276818	hsa-miR-3158-5p	CLIP-seq
MIRT2276819	hsa-miR-3173-5p	CLIP-seq
MIRT2276820	hsa-miR-3179	CLIP-seq
MIRT2276821	hsa-miR-3192	CLIP-seq
MIRT2276822	hsa-miR-3202	CLIP-seq
MIRT2276823	hsa-miR-323-5p	CLIP-seq
MIRT2276824	hsa-miR-3689a-3p	CLIP-seq
MIRT2276825	hsa-miR-3689c	CLIP-seq
MIRT2276826	hsa-miR-371b-3p	CLIP-seq
MIRT2276827	hsa-miR-3907	CLIP-seq
MIRT2276828	hsa-miR-4323	CLIP-seq
MIRT2276829	hsa-miR-4421	CLIP-seq
MIRT1166392	hsa-miR-4438	CLIP-seq
MIRT2276830	hsa-miR-4447	CLIP-seq
MIRT1166394	hsa-miR-4450	CLIP-seq
MIRT1166395	hsa-miR-4455	CLIP-seq
MIRT2276831	hsa-miR-4456	CLIP-seq
MIRT2276832	hsa-miR-4472	CLIP-seq
MIRT2276833	hsa-miR-4483	CLIP-seq
MIRT2276834	hsa-miR-4488	CLIP-seq
MIRT1166397	hsa-miR-4492	CLIP-seq
MIRT1166398	hsa-miR-4498	CLIP-seq
MIRT1166399	hsa-miR-4505	CLIP-seq
MIRT2276835	hsa-miR-4514	CLIP-seq
MIRT2276836	hsa-miR-4536	CLIP-seq
MIRT2276837	hsa-miR-4651	CLIP-seq
MIRT1166402	hsa-miR-4667-5p	CLIP-seq
MIRT2276838	hsa-miR-4670-5p	CLIP-seq
MIRT2276839	hsa-miR-4690-3p	CLIP-seq
MIRT2276840	hsa-miR-4690-5p	CLIP-seq
MIRT2276841	hsa-miR-4692	CLIP-seq
MIRT2276842	hsa-miR-4697-5p	CLIP-seq
MIRT1166403	hsa-miR-4700-5p	CLIP-seq
MIRT2276843	hsa-miR-4713-5p	CLIP-seq
MIRT2276844	hsa-miR-4725-5p	CLIP-seq
MIRT2276845	hsa-miR-4727-5p	CLIP-seq
MIRT2276846	hsa-miR-4728-5p	CLIP-seq
MIRT1166404	hsa-miR-4731-5p	CLIP-seq
MIRT2276847	hsa-miR-4747-5p	CLIP-seq
MIRT2276848	hsa-miR-4763-3p	CLIP-seq
MIRT2276849	hsa-miR-4768-3p	CLIP-seq
MIRT2276850	hsa-miR-4804-5p	CLIP-seq
MIRT2276851	hsa-miR-504	CLIP-seq
MIRT2276852	hsa-miR-532-3p	CLIP-seq
MIRT2276853	hsa-miR-541	CLIP-seq
MIRT2276854	hsa-miR-550a	CLIP-seq
MIRT2276855	hsa-miR-608	CLIP-seq
MIRT1166406	hsa-miR-609	CLIP-seq
MIRT2276856	hsa-miR-654-5p	CLIP-seq
MIRT2276857	hsa-miR-661	CLIP-seq
MIRT2276858	hsa-miR-665	CLIP-seq
MIRT1166410	hsa-miR-762	CLIP-seq
MIRT2276859	hsa-miR-874	CLIP-seq
MIRT2276860	hsa-miR-885-3p	CLIP-seq
MIRT2276812	hsa-miR-205	CLIP-seq
MIRT2276813	hsa-miR-2278	CLIP-seq
MIRT2276817	hsa-miR-3157-5p	CLIP-seq
MIRT2276828	hsa-miR-4323	CLIP-seq
MIRT2276835	hsa-miR-4514	CLIP-seq
MIRT2276839	hsa-miR-4690-3p	CLIP-seq
MIRT2276840	hsa-miR-4690-5p	CLIP-seq
MIRT2276841	hsa-miR-4692	CLIP-seq
MIRT2276849	hsa-miR-4768-3p	CLIP-seq
MIRT2276858	hsa-miR-665	CLIP-seq
MIRT2276812	hsa-miR-205	CLIP-seq
MIRT2276813	hsa-miR-2278	CLIP-seq
MIRT2276817	hsa-miR-3157-5p	CLIP-seq
MIRT2276828	hsa-miR-4323	CLIP-seq
MIRT2276835	hsa-miR-4514	CLIP-seq
MIRT2276839	hsa-miR-4690-3p	CLIP-seq
MIRT2276840	hsa-miR-4690-5p	CLIP-seq
MIRT2276841	hsa-miR-4692	CLIP-seq
MIRT2276849	hsa-miR-4768-3p	CLIP-seq
MIRT2276858	hsa-miR-665	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	15979574
RELA	Unknown	15979574
SP1	Activation	15979574
SP3	Activation	15979574

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	IBA
GO:0005201	Function	Extracellular matrix structural constituent	NAS	7680650
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0030277	Process	Maintenance of gastrointestinal epithelium	NAS	7680650
GO:0031012	Component	Extracellular matrix	IBA

Other IDs

• MIM: 158374
• HGNC: 7517
• e!Ensembl: ENSG00000184956

Protein

• UniProt ID: Q6W4X9
• Protein name: Mucin-6 (MUC-6) (Gastric mucin-6)
• Protein function: May provide a mechanism for modulation of the composition of the protective mucus layer related to acid secretion or the presence of bacteria and noxious agents in the lumen. Plays an important role in the cytoprotection of epithelial surfaces a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00094	VWD	45 → 193	von Willebrand factor type D domain	Family
  PF08742	C8	231 → 297	C8 domain	Domain
  PF01826	TIL	302 → 357	Trypsin Inhibitor like cysteine rich domain	Domain
  PF00094	VWD	397 → 550	von Willebrand factor type D domain	Family
  PF08742	C8	591 → 660	C8 domain	Domain
  PF01826	TIL	764 → 827	Trypsin Inhibitor like cysteine rich domain	Domain
  PF00094	VWD	868 → 1019	von Willebrand factor type D domain	Family
  PF08742	C8	1060 → 1127	C8 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the regenerative zone of gastric antrum, gastric body mucosa and gastric incisura mucosa. Expressed in the deeper mucous glands of gastric antrum. Overexpressed in Helicobacter pylori infected gastric epithelium. Highly ex
• Sequence:

  MVQRWLLLSCCGALLSAGLANTSYTSPGLQRLKDSPQTAPDKGQCSTWGAGHFSTFDHHV
  YDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSISRIIVELGASVVTVSEAIISVKDIGV
  ISLPYTSNGLQITPFGQSVRLVAKQLELELEVVWGPDSHLMVLVERKYMGQMCGLCGNFD
  GKVTNEFVSEEGKFLEPHKFAALQKLDDPGEICTFQDIPSTHVRQAQHARICTQLLTLVA
  PECSVSKEPFVLSCQADVAAAPQPGPQNSSCATLSEYSRQCSMVGQPVRRWRSPGLCSVG
  QCPANQVYQECGSACVKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSNNHTCVPVTQCPCV
  LHGAMYAPGEVTIAACQTCRCTLGRWVCTERPCPGHCSLEGGSFVTTFDARPYRFHGTCT
  YILLQSPQLPEDGALMAVYDKSGVSHSETSLVAVVYLSRQDKIVISQDEVVTNNGEAKWL
  PYKTRNITVFRQTSTHLQMATSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDT
  TDDFTTSMGIAEGTASLFVDSWRAGNCPAALERETDPCSMSQLNKVCAETHCSMLLRTGT
  VFERCHATVNPAPFYKRCVYQACNYEETFPHICAALGDYVHACSLRGVLLWGWRSSVDNC
  TIPCTGNTTFSYNSQACERTCLSLSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQ
  CPCILEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENK
  FGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGVSYPGGA
  ELHTDCRTCSCSRGRWACQQGTHCPSTCTLYGEGHVITFDGQRFVFDGNCEYILATDVCG
  VNDSQPTFKILTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLGVTPG
  ALSLVVDISIPGRYNLTLIWNRHMTILIRIARASQDPLCGLCGNFNGNMKDDFETRSRYV
  ASSELELVNSWKESPLCGDVSFVTDPCSLNAFRRSWAERKCSVINSQTFATCHSKVYHLP
  YYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVDWRTPAFCPIYCGFYNTHTQD
  GHGEYQYTQEANCTWHYQPCLCPSQPQSVPGSNIEGCYNCSQDEYFDHEEGVCVPCMPPT
  TPQPPTTPQLPTTGSRPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQTPLLPATLT
  SSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTST
  AQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTGPTTPQPGQP
  TRPTATETTQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFHATTTYPTPSHPE
  TTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPTTLKATGSTHTAP
  PITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTPTSTTTITPNPTSTRTRTPVAH
  TNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSHPQTTLPTHVPPFS
  TSLVTPSTHTVITPTHAQMATSASIHSMPTGTIPPPTTLKATGSTHTAPTMTLTTSGTSQ
  ALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVTTSGTSQSRSSF
  STAKTSTSLHSHTSSTHHPEVTSTSTTSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTH
  SPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTTLPTHVPSFSTSLVTPSTHTVIIPTH
  TQMATSASIHSMPTGTIPPPTTIKATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPY
  HTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAHTTSASSSRLPTPFTTHSPPTGSSPFSS
  TGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVIITTHTQMATSASIHS
  TPTGTVPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSS
  RPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVG
  TSSSFVSAPVHSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPF
  TLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRV
  PTSGFVSLTSGVTGIPTSPVTNLTTRHPGPTLSPTTRFLTSSLTAHGSTPASAPVSSLGT
  PTPTSPGVCSVREQQEEITFKGCMANVTVTRCEGACISAASFNIITQQVDARCSCCRPLH
  SYEQQLELPCPDPSTPGRRLVLTLQVFSHCVCSSVACGD

• Sequence length: 2439

Pathways

Reactome:

Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	10209489, 15086835, 15910596, 23382633, 24138592, 27766003, 28321517, 29187465, 29278427, 29658052, 29664741, 29956011, 30324235, 31076280, 31567280, 31815746		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17401217		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10100757		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of duodenum	Adenocarcinoma Of Duodenum	BEFREE	26517627		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15151204		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	23054008		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	BEFREE	19102008		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17085661, 23404616		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	12820724, 9935202		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	17676483		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	9935202		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	19266212		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31748784	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	31748784		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	33569969	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11076872, 15563666, 17401217, 24550372	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23382633		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	33020993	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16148312, 16449349		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11253133, 15976813, 27846863	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	37581476	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	11274635, 15151204		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12077147, 16545139, 20139757, 23573304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10209489, 12010365, 15086835, 16447040, 16804962, 30258209, 30710095		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	23446997	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11253133	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	31506488	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30580903		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25906442	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	24722639	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28099906	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10209489		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29698701	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	BEFREE	9425917, 9713347		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15500651		★☆☆☆☆ Found in Text Mining only
Coffin-Lowry syndrome	Coffin-Lowry Syndrome	BEFREE	22524666		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	19855374, 20929551	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23054008, 23807779, 25081749		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23807779, 25081749, 27298226, 39333321	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11559653, 33690604	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	9234245		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	16325508, 23643621		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	33608531	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	17197898		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31021421		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28697153		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24138592		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	23643621		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	21596555, 29658052		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	23054008		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	24816253		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	28489708		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	20139757	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30047301		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31514468		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11559653, 30504806		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11559653	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14960508, 16545139	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	12360467		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29698701		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	12360467, 28685935		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	16475027		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20139757, 37581476	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34672134	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16449349, 23370770		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	21851820		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30580903		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10209489, 21851820, 28685935		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14760390, 16475027		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16647036, 17459057, 19924550, 9419405		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	24816253		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20506113, 23054008, 29658052, 30580903		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25881098	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	28649694, 30138216		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	11559653	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16076710		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11101634, 12010365, 12360467, 15151204, 15838649, 16260276, 16447040, 16804962, 21723776, 21851820, 23782334, 23807779, 25143129, 28321517, 28453172, 28649694, 28776573, 31021421, 31815746		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	17479161	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21851820, 28685935		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	34808019	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28685935, 29845361		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24303806, 28099906, 28685935, 29550476	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34808019	Inhibit	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	33608531	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	9935202		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14760390, 16475027		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16475027		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32800727	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30047301		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23054008		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	21723776		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23112547		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37581476	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12692839, 16647036, 19924550, 20506113, 24138592, 9419405		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	15143335, 15962383	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	16325508		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10940270, 11278696, 12719460, 15354218, 15962383, 18938748, 19924550, 21777278, 24138592, 25945027, 26685087, 31243897, 31506488, 34840985, 36450891, 37085819, 37967684, 38041130	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	24816253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	34672134	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	15976813	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	23807779		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16924127		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25197366	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	28685935, 33020993	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33020993	Associate	★☆☆☆☆ Found in Text Mining only