MUC4 (mucin 4, cell surface associated)

Gene

• Entrez ID: 4585
• Gene name: Mucin 4, cell surface associated
• Gene symbol: MUC4
• Synonyms (NCBI Gene): ASGP, HSA276359, MUC-4
• Chromosome: 3
• Chromosome location: 3q29
• Summary: The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epith

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006115	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	21983127
MIRT006115	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	21983127
MIRT006115	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	21983127
MIRT006115	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	21983127
MIRT006115	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	21983127
MIRT006115	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	21983127
MIRT017552	hsa-miR-335-5p	Microarray	18185580
MIRT646755	hsa-miR-3614-3p	HITS-CLIP	23824327
MIRT646754	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT646753	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646752	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646751	hsa-miR-3660	HITS-CLIP	23824327
MIRT646750	hsa-miR-4526	HITS-CLIP	23824327
MIRT646749	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT646748	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT646747	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT646746	hsa-miR-623	HITS-CLIP	23824327
MIRT646745	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646744	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646743	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT646742	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT646741	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT646740	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT646744	hsa-miR-211-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27923652
MIRT646744	hsa-miR-211-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27923652
MIRT646755	hsa-miR-3614-3p	HITS-CLIP	23824327
MIRT646754	hsa-miR-4704-3p	HITS-CLIP	23824327
MIRT646753	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646752	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646751	hsa-miR-3660	HITS-CLIP	23824327
MIRT646750	hsa-miR-4526	HITS-CLIP	23824327
MIRT646749	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT646748	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT646747	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT646746	hsa-miR-623	HITS-CLIP	23824327
MIRT646745	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646744	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646743	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT646742	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT646741	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT646740	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT646745	hsa-miR-204-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34783868
MIRT1166350	hsa-miR-3655	CLIP-seq
MIRT1166351	hsa-miR-431	CLIP-seq
MIRT1166352	hsa-miR-511	CLIP-seq
MIRT1166353	hsa-miR-548ag	CLIP-seq
MIRT1166354	hsa-miR-548ai	CLIP-seq
MIRT1166355	hsa-let-7a	CLIP-seq
MIRT1166356	hsa-let-7b	CLIP-seq
MIRT1166357	hsa-let-7c	CLIP-seq
MIRT1166358	hsa-let-7d	CLIP-seq
MIRT1166359	hsa-let-7e	CLIP-seq
MIRT1166360	hsa-let-7f	CLIP-seq
MIRT1166361	hsa-let-7g	CLIP-seq
MIRT1166362	hsa-let-7i	CLIP-seq
MIRT1166363	hsa-miR-202	CLIP-seq
MIRT1166364	hsa-miR-3135	CLIP-seq
MIRT1166365	hsa-miR-4458	CLIP-seq
MIRT1166366	hsa-miR-4500	CLIP-seq
MIRT1166367	hsa-miR-4717-5p	CLIP-seq
MIRT1166368	hsa-miR-526b	CLIP-seq
MIRT1166369	hsa-miR-627	CLIP-seq
MIRT1166370	hsa-miR-924	CLIP-seq
MIRT1166371	hsa-miR-98	CLIP-seq
MIRT2048050	hsa-miR-3185	CLIP-seq
MIRT2048051	hsa-miR-4635	CLIP-seq
MIRT2048052	hsa-miR-4709-3p	CLIP-seq
MIRT2454620	hsa-miR-150	CLIP-seq
MIRT2454621	hsa-miR-3908	CLIP-seq
MIRT2454622	hsa-miR-4713-5p	CLIP-seq
MIRT2454623	hsa-miR-532-3p	CLIP-seq
MIRT2454624	hsa-miR-566	CLIP-seq
MIRT2454625	hsa-miR-652	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Activation	19757157
CREB1	Unknown	11418607
E2F1	Activation	22537161
ELK1	Activation	19757157
ETS1	Activation	19757157
ETV4	Activation	15461591
NR3C1	Unknown	11418607
SP1	Unknown	11418607
SP3	Unknown	11418607
STAT1	Activation	19757157;22537161
STAT3	Activation	18573283
STAT3	Unknown	15485908
TFAP2A	Repression	17621592
TFAP2A	Unknown	11418607
TFAP4	Unknown	11418607
YY1	Repression	23813057

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005176	Function	ErbB-2 class receptor binding	IBA
GO:0005176	Function	ErbB-2 class receptor binding	TAS	10024507
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10024507
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10920259
GO:0030197	Function	Extracellular matrix constituent, lubricant activity	NAS	10920259
GO:0030277	Process	Maintenance of gastrointestinal epithelium	IMP	17058067
GO:0031012	Component	Extracellular matrix	NAS	10920259
GO:0031982	Component	Vesicle	HDA	19190083
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145

Other IDs

• MIM: 158372
• HGNC: 7514
• e!Ensembl: ENSG00000145113

Protein

• UniProt ID: Q99102
• Protein name: Mucin-4 (MUC-4) (Ascites sialoglycoprotein) (ASGP) (Pancreatic adenocarcinoma mucin) (Testis mucin) (Tracheobronchial mucin) [Cleaved into: Mucin-4 alpha chain (Ascites sialoglycoprotein 1) (ASGP-1); Mucin-4 beta chain (Ascites sialoglycoprotein 2) (ASGP-
• Protein function: Membrane-bound mucin, a family of highly glycosylated proteins that constitute the major component of the mucus, the slimy and viscous secretion covering epithelial surfaces (PubMed:10880978). These glycoproteins play important roles in the prot
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06119	NIDO	1224 → 1308	Nidogen-like	Family
  PF00094	VWD	1439 → 1611	von Willebrand factor type D domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such
• Sequence:

  MKGARWRRVPWVSLSCLCLCLLPHVVPGTTEDTLITGSKTAAPVTSTGSTTATLEGQSTA
  ASSRTSNQDISASSQNHQTKSTETTSKAQTDTLTQMMTSTLFSSPSVHNVMETVTQETAP
  PDEMTTSFPSSVTNTLMMTSKTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQ
  EGQSRTTSWRTSIQDTSASSQNHWTRSTQTTRESQTSTLTHRTTSTPSFSPSVHNVTGTV
  SQKTSPSGETATSSLCSVTNTSMMTSEKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSA
  ALVTVDPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSS
  PSGFNPSGTVSQETFPSGETTISSPSSVSNTFLVTSKVFRMPISRDSTLGNTEETSLSVS
  GTISAITSKVSTIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGV
  SQEIFTLHETTTWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPSTRAAGTIPRVPSK
  VSAIGEPGEPTTYSSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVIQMIKTATS
  PSSSPMLDRHTSQQITTAPSTNHSTIHSTSTSPQESPAVSQRGHTRAPQTTQESQTTRSV
  SPMTDTKTVTTPGSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGNGHTTQAPTTALQA
  APSSHDATLGPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQ
  AESTEASGQTQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPS
  RDSHTTQSTTELLSASASHGAIPVSTGMASSIVPGTFHPTLSEASTAGRPTGQSSPTSPS
  ASPQETAAISRMAQTQRTGTSRGSDTISLASQATDTFSTVPPTPPSITSSGLTSPQTQTH
  TLSPSGSGKTFTTALISNATPLPVTSTSSASTGHATPLAVSSATSASTVSSDSPLKMETS
  GMTTPSLKTDGGRRTATSPPPTTSQTIISTIPSTAMHTRSTAAPIPILPERGVSLFPYGA
  GAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLP
  TGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHSLLVQQAESWIRKMTNNGGY
  KARWALKVTWVNAHAYPAQWTLGSNTYQAILSTDGSRSYALFLYQSGGMQWDVAQRSGNP
  VLMGFSSGDGYFENSPLMSQPVWERYRPDRFLNSNSGLQGLQFYRLHREERPNYRLECLQ
  WLKSQPRWPSWGWNQVSCPCSWQQGRRDLRFQPVSIGRWGLGSRQLCSFTSWRGGVCCSY
  GPWGEFREGWHVQRPWQLAQELEPQSWCCRWNDKPYLCALYQQRRPHVGCATYRPPQPAW
  MFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQATNFIAFAAQYR
  SSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNATGVLLSRNGSEVSAS
  FDGWATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEE
  MLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGDSSCIYDT
  LALRNASIGLHTREVSKNYEQANATLNQYPPSINGGRVIEAYKGQTTLIQYTSNAEDANF
  TLRDSCTDLELFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAESQCL
  YNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPNLTG
  DGRHCAALGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNF
  SPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPAS
  GSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISGE
  DVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPR
  CSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGALGGLLLLGVGTFVVLRFWGCSGARFSY
  FLNSAEALP

• Sequence length: 2169

Pathways

Reactome:

Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASE ASSOCIATED WITH CYSTIC FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	11101635, 12657964, 15184872, 15461591, 16007204, 17406026, 18573283, 18781152, 20303649, 21889495, 24037917, 26613889, 27283771, 27481516, 29317712, 30236127, 30952968, 31076280, 8694545		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15184872, 16799633, 18381409		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21889495		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24037917, 24241961, 28065467, 29317712, 30236127, 30329165, 30683132		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11751498, 12657964, 16799633, 17525742, 22580602, 24204560		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12210083		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30382607		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	GWASCAT_DG	28552477		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23102107, 24608432, 24714692		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	27283771	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34995380	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	18547287		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33834070	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11076872, 14583090, 15563666	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasm	Biliary Tract Neoplasm	LHGDN	18475301		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	18475301	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30236127		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	17090193	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11547901, 25106087, 28892049, 28915583, 29281999		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15976813, 16690615, 19761616, 27846863, 29281999, 37239898, 37454130, 38243319	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	11274635		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10940270, 14583090, 15461591, 17037983, 23497483, 36400876	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11418607, 11578957, 11893501, 16302265, 16500040, 19127263, 21415703, 25367394, 27829225, 30236127		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	18665193, 24671186, 37905642	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	20228782	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	17425390	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	24437456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	21072847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30236127		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11596032, 16779668, 23370366, 24204934, 24241961, 29317712, 8638091, 8694545		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	15461591, 16049287, 24228110, 24476519, 24714692, 27283771, 33328627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25753955, 27124015, 28128276, 33501493	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17425390, 20591909, 8638091	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19188823, 29317712	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18665193		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	25522282		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33860048	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29281999		★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	37839777	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17243165, 27923652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	17243165, 27923652		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30382607		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	19082442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37324940	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15500651		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	11350794		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	27639937		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31826065	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1394223, 19127263, 30236127		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	26898938	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20564074, 32949121	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10463611, 23566254, 25124610, 25573589, 29782466, 31091244		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20564074, 23497483, 23566254, 25124610, 25295732, 25573589, 30236127, 30683863, 31091244, 33431054, 33714943, 37384668, 38492821, 39333321	Associate	★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	30431579	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27124015		★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	22614008		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11559653, 28885228, 34469062, 36817485	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17058067		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	35065708	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	16799633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26417704		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	GWASCAT_DG	26417704		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	35065708	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry eye syndrome	Pubtator	21245952, 37106448	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	12657964		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	17197898, 25923310		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25923310		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17090193	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21349170, 26285705		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21349170, 24939955, 26285705	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29691386, 35437997	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	18492726		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17037983, 21889495		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21889495		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17037983, 26673820	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30112770		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23101681	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	14583090	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	17037983	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31383964		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24582898		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36400876	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24582898		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	36400876	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Growth Disorders	Growth disorder	Pubtator	30431579	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	22614008		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	31652145		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20591909	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27109098	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32887938	Stimulate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	21349170, 24939955, 26285705	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17058067		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28885228		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28885228	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24992172		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27477082	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	30431579	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	19787286		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	29843125		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10507763, 29269214, 3863106		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	3863106		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	14657954, 23370366, 24204934, 29317712, 29560830, 8638091	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	8638091		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	16475027		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19761616	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23101681, 23152882	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11547901, 25106087, 28892049, 28915583, 29281999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25923310		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	14583090, 17037983, 21889495		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28838233		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16779668, 23370366, 24204934, 24241961, 8638091, 8694545		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18665193, 9850092		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15867264, 17406026, 18381409, 19757157, 20303649, 21983127, 22105367, 22537161, 22580602, 22614008, 22791819, 23102107, 23928463, 24204560, 24608432, 25275019, 25367394, 25531332, 25686822, 26477488, 26526617, 27109098, 27287498, 28060749, 28270046, 28460571, 29777904, 30236127, 31723153, 8143972		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16302265, 27829225		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30236127		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18781152, 23464473, 30236127		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30236127		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10507763, 11596032, 11751498, 15243562, 18298336, 18492726, 18665193, 19127263, 19757157, 19787286, 23307400, 23370366, 23921963, 24037917, 24714692, 25367394, 25923310, 26477488, 27287244, 27698002, 27829225, 27838635, 28065467, 28339085, 29896226, 30236127, 31723153		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30382607		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17243165, 27923652		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	1394223, 19127263, 30236127		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16690615, 35688970	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20591909	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	30112770		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	28128276, 29317712	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33501493	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	12210083		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	LHGDN	15897748		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	21072847, 28628803, 28649694		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12110007		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16076710, 16630149, 17891050, 27639937		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	17891050		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33790390	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27124015	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10232613, 10918186, 11547901, 11751498, 12657964, 14760381, 16799633, 17406026, 18298336, 18651706, 18781152, 19818375, 20410810, 21072847, 21415703, 21723776, 21889495, 21983127, 22819758, 22982887, 23370366, 23928463, 24204934, 24241961, 24608432, 25353281, 25367394, 25753955, 25761907, 25923310, 27124015, 27287498, 27698002, 27748843, 28065467, 28270046, 28339085, 28460571, 28548128, 28649694, 28892049, 28915583, 29777904, 29778426, 30112770, 30306072, 31652145, 8694545, 9850092		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	31132652		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	29843125		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31698611, 33172452	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21647207		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23370366		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	24992172		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	32887938	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24921641, 25496518		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	LHGDN	14690056		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	11350794		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18665193		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18665193		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16880776, 18665193, 23370366, 32650224	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10920259, 10938282, 15867264, 17406026, 18381409, 19757157, 20303649, 21983127, 22105367, 22537161, 22580602, 22614008, 22791819, 23102107, 23921963, 23928463, 24204560, 24608432, 25275019, 25367394, 25531332, 25686822, 26477488, 26526617, 27109098, 27287498, 28060749, 28270046, 28460571, 29777904, 30236127, 31723153, 8143972		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	12657964, 17621592, 26526617, 28270046, 28460571, 29061782		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	10920259, 14744777, 22537161, 22580602, 22614008, 24608432, 27109098, 27748843		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14744777, 15184872, 17406026		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10920259, 10938282, 11418607, 15461591, 17406026, 17595659, 18157915, 18381409, 20303649, 20423995, 21059814, 22580602, 24204560, 24714692, 24971005, 25367394, 27109098, 27230679, 27237318, 27283771, 28060749, 29550476, 29777904, 30236127, 30794864, 33082357	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22537161, 23544943	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	24476519	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	11751498		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29896226		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	37839777	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26686060, 28005264		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26686060	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16302265, 27829225		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16302265, 16475027		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34512870	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28198987	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	15867264		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	33368602	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15867264		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22387046, 22819758, 24856853, 28965630, 31385070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	20591909	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	30236127	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	21415703, 22982887, 30112770		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	30431579	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11093805, 16700662, 29317712		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26673820		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33315534, 33544383, 37080394	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29317712		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18781152, 23464473, 30236127		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	23921963, 24714692, 25573589	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10940270	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18573283, 18781152		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18573283, 23152882, 23464473, 26330360, 30236127, 31915505, 32701958	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	20062084		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	22982887		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30366040		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30366040	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16924127, 17058067		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24671186, 25197366, 30236127	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	15563666	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19188823, 23446997	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	24939955	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	20591909	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	16807280		★☆☆☆☆ Found in Text Mining only