Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4507
Gene name	Methylthioadenosine phosphorylase
Gene symbol	MTAP
Synonyms (NCBI Gene)	BDMFDMSFHDMSMFHHEL-249LGMBFMSAPc86fus
Chromosome	9
Chromosome location	9p21.3
Summary	This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted

464

Show/Hide all (464)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000961	hsa-miR-21-5p	Western blotNorthern blot	19013014
MIRT000961	hsa-miR-21-5p	qRT-PCR	19013014
MIRT000961	hsa-miR-21-5p	Luciferase reporter assay	19013014
MIRT020610	hsa-miR-155-5p	Proteomics	18668040
MIRT025319	hsa-miR-34a-5p	Sequencing	20371350
MIRT025319	hsa-miR-34a-5p	Proteomics	21566225
MIRT025319	hsa-miR-34a-5p	Proteomics	21566225
MIRT000961	hsa-miR-21-5p	Microarray	18591254
MIRT000961	hsa-miR-21-5p	Microarray	18591254
MIRT662554	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT662553	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT662552	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT662551	hsa-miR-5693	HITS-CLIP	23824327
MIRT662550	hsa-miR-1267	HITS-CLIP	23824327
MIRT662549	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT662548	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT662547	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT662546	hsa-miR-3135b	HITS-CLIP	23824327
MIRT662545	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT662544	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT662543	hsa-miR-3652	HITS-CLIP	23824327
MIRT662541	hsa-miR-4430	HITS-CLIP	23824327
MIRT662542	hsa-miR-200c-5p	HITS-CLIP	23824327
MIRT662540	hsa-miR-550a-3p	HITS-CLIP	23824327
MIRT662539	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT662538	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT662537	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT662536	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT662535	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT662534	hsa-miR-5698	HITS-CLIP	23824327
MIRT527968	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT527967	hsa-miR-5688	PAR-CLIP	22012620
MIRT527966	hsa-miR-4717-3p	PAR-CLIP	22012620
MIRT527965	hsa-miR-1237-3p	PAR-CLIP	22012620
MIRT527964	hsa-miR-1248	PAR-CLIP	22012620
MIRT527963	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT527962	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT527961	hsa-miR-6837-3p	PAR-CLIP	22012620
MIRT527960	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT527959	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT527958	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT527957	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT527956	hsa-miR-23c	PAR-CLIP	22012620
MIRT527955	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT454726	hsa-miR-4662a-3p	PAR-CLIP	23592263
MIRT454725	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT454724	hsa-miR-577	PAR-CLIP	23592263
MIRT454723	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT454722	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT454721	hsa-miR-421	PAR-CLIP	23592263
MIRT454720	hsa-miR-5585-3p	PAR-CLIP	23592263
MIRT662554	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT662553	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT662552	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT662551	hsa-miR-5693	HITS-CLIP	23824327
MIRT662550	hsa-miR-1267	HITS-CLIP	23824327
MIRT662549	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT662548	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT662547	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT662546	hsa-miR-3135b	HITS-CLIP	23824327
MIRT662545	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT662544	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT662543	hsa-miR-3652	HITS-CLIP	23824327
MIRT662541	hsa-miR-4430	HITS-CLIP	23824327
MIRT662542	hsa-miR-200c-5p	HITS-CLIP	23824327
MIRT662540	hsa-miR-550a-3p	HITS-CLIP	23824327
MIRT662539	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT662538	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT662537	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT662536	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT662535	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT662534	hsa-miR-5698	HITS-CLIP	23824327
MIRT527968	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT527967	hsa-miR-5688	PAR-CLIP	22012620
MIRT527966	hsa-miR-4717-3p	PAR-CLIP	22012620
MIRT527965	hsa-miR-1237-3p	PAR-CLIP	22012620
MIRT527964	hsa-miR-1248	PAR-CLIP	22012620
MIRT527963	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT527962	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT527961	hsa-miR-6837-3p	PAR-CLIP	22012620
MIRT527960	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT527959	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT527958	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT527957	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT527956	hsa-miR-23c	PAR-CLIP	22012620
MIRT527955	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT454726	hsa-miR-4662a-3p	PAR-CLIP	23592263
MIRT454725	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT454724	hsa-miR-577	PAR-CLIP	23592263
MIRT454723	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT454722	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT454721	hsa-miR-421	PAR-CLIP	23592263
MIRT454720	hsa-miR-5585-3p	PAR-CLIP	23592263
MIRT1162199	hsa-miR-1193	CLIP-seq
MIRT1162200	hsa-miR-1204	CLIP-seq
MIRT1162201	hsa-miR-1253	CLIP-seq
MIRT1162202	hsa-miR-1262	CLIP-seq
MIRT1162203	hsa-miR-1279	CLIP-seq
MIRT1162204	hsa-miR-128	CLIP-seq
MIRT1162205	hsa-miR-1290	CLIP-seq
MIRT1162206	hsa-miR-1293	CLIP-seq
MIRT1162207	hsa-miR-1299	CLIP-seq
MIRT1162208	hsa-miR-142-3p	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT1162210	hsa-miR-1470	CLIP-seq
MIRT1162211	hsa-miR-154	CLIP-seq
MIRT1162212	hsa-miR-15a	CLIP-seq
MIRT1162213	hsa-miR-15b	CLIP-seq
MIRT1162214	hsa-miR-16	CLIP-seq
MIRT1162215	hsa-miR-188-3p	CLIP-seq
MIRT1162216	hsa-miR-195	CLIP-seq
MIRT1162217	hsa-miR-1972	CLIP-seq
MIRT1162218	hsa-miR-1976	CLIP-seq
MIRT1162219	hsa-miR-2392	CLIP-seq
MIRT1162220	hsa-miR-2467-5p	CLIP-seq
MIRT1162221	hsa-miR-27a	CLIP-seq
MIRT1162222	hsa-miR-27b	CLIP-seq
MIRT1162223	hsa-miR-298	CLIP-seq
MIRT1162224	hsa-miR-3123	CLIP-seq
MIRT1162225	hsa-miR-3144-5p	CLIP-seq
MIRT1162226	hsa-miR-3154	CLIP-seq
MIRT1162227	hsa-miR-3156-3p	CLIP-seq
MIRT1162228	hsa-miR-3163	CLIP-seq
MIRT1162229	hsa-miR-3175	CLIP-seq
MIRT1162230	hsa-miR-3179	CLIP-seq
MIRT1162231	hsa-miR-3182	CLIP-seq
MIRT1162232	hsa-miR-3191	CLIP-seq
MIRT1162233	hsa-miR-3199	CLIP-seq
MIRT1162234	hsa-miR-338-5p	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT1162236	hsa-miR-3606	CLIP-seq
MIRT1162237	hsa-miR-361-3p	CLIP-seq
MIRT1162238	hsa-miR-3647-3p	CLIP-seq
MIRT1162239	hsa-miR-3653	CLIP-seq
MIRT1162240	hsa-miR-3655	CLIP-seq
MIRT1162241	hsa-miR-3658	CLIP-seq
MIRT1162242	hsa-miR-378	CLIP-seq
MIRT1162243	hsa-miR-378b	CLIP-seq
MIRT1162244	hsa-miR-378c	CLIP-seq
MIRT1162245	hsa-miR-378d	CLIP-seq
MIRT1162246	hsa-miR-378e	CLIP-seq
MIRT1162247	hsa-miR-378f	CLIP-seq
MIRT1162248	hsa-miR-378h	CLIP-seq
MIRT1162249	hsa-miR-378i	CLIP-seq
MIRT1162250	hsa-miR-3912	CLIP-seq
MIRT1162251	hsa-miR-3915	CLIP-seq
MIRT1162252	hsa-miR-3919	CLIP-seq
MIRT1162253	hsa-miR-3925-5p	CLIP-seq
MIRT1162254	hsa-miR-3928	CLIP-seq
MIRT1162255	hsa-miR-422a	CLIP-seq
MIRT1162256	hsa-miR-424	CLIP-seq
MIRT1162257	hsa-miR-4261	CLIP-seq
MIRT1162258	hsa-miR-4272	CLIP-seq
MIRT1162259	hsa-miR-4278	CLIP-seq
MIRT1162260	hsa-miR-4282	CLIP-seq
MIRT1162261	hsa-miR-4301	CLIP-seq
MIRT1162262	hsa-miR-431	CLIP-seq
MIRT1162263	hsa-miR-4434	CLIP-seq
MIRT1162264	hsa-miR-4436b-5p	CLIP-seq
MIRT1162265	hsa-miR-4477a	CLIP-seq
MIRT1162266	hsa-miR-4483	CLIP-seq
MIRT1162267	hsa-miR-4516	CLIP-seq
MIRT1162268	hsa-miR-4524	CLIP-seq
MIRT1162269	hsa-miR-4638-3p	CLIP-seq
MIRT1162270	hsa-miR-4650-5p	CLIP-seq
MIRT1162271	hsa-miR-4652-5p	CLIP-seq
MIRT1162272	hsa-miR-4659a-3p	CLIP-seq
MIRT1162273	hsa-miR-4659b-3p	CLIP-seq
MIRT1162274	hsa-miR-4662a-5p	CLIP-seq
MIRT1162275	hsa-miR-4666-3p	CLIP-seq
MIRT1162276	hsa-miR-4667-3p	CLIP-seq
MIRT1162277	hsa-miR-4676-5p	CLIP-seq
MIRT1162278	hsa-miR-4701-3p	CLIP-seq
MIRT1162279	hsa-miR-4705	CLIP-seq
MIRT1162280	hsa-miR-4716-3p	CLIP-seq
MIRT1162281	hsa-miR-4717-5p	CLIP-seq
MIRT1162282	hsa-miR-4723-5p	CLIP-seq
MIRT1162283	hsa-miR-4764-3p	CLIP-seq
MIRT1162284	hsa-miR-4777-3p	CLIP-seq
MIRT1162285	hsa-miR-4782-5p	CLIP-seq
MIRT1162286	hsa-miR-4790-3p	CLIP-seq
MIRT1162287	hsa-miR-4793-5p	CLIP-seq
MIRT1162288	hsa-miR-491-5p	CLIP-seq
MIRT1162289	hsa-miR-495	CLIP-seq
MIRT1162290	hsa-miR-497	CLIP-seq
MIRT1162291	hsa-miR-503	CLIP-seq
MIRT1162292	hsa-miR-511	CLIP-seq
MIRT1162293	hsa-miR-516b	CLIP-seq
MIRT1162294	hsa-miR-532-3p	CLIP-seq
MIRT1162295	hsa-miR-548a-5p	CLIP-seq
MIRT1162296	hsa-miR-548ab	CLIP-seq
MIRT1162297	hsa-miR-548ac	CLIP-seq
MIRT1162298	hsa-miR-548ae	CLIP-seq
MIRT1162299	hsa-miR-548aj	CLIP-seq
MIRT1162300	hsa-miR-548ak	CLIP-seq
MIRT1162301	hsa-miR-548am	CLIP-seq
MIRT1162302	hsa-miR-548b-5p	CLIP-seq
MIRT1162303	hsa-miR-548c-5p	CLIP-seq
MIRT1162304	hsa-miR-548d-3p	CLIP-seq
MIRT1162305	hsa-miR-548d-5p	CLIP-seq
MIRT1162306	hsa-miR-548h	CLIP-seq
MIRT1162307	hsa-miR-548i	CLIP-seq
MIRT1162308	hsa-miR-548j	CLIP-seq
MIRT1162309	hsa-miR-548n	CLIP-seq
MIRT1162310	hsa-miR-548p	CLIP-seq
MIRT1162311	hsa-miR-548w	CLIP-seq
MIRT1162312	hsa-miR-548x	CLIP-seq
MIRT1162313	hsa-miR-548y	CLIP-seq
MIRT1162314	hsa-miR-548z	CLIP-seq
MIRT1162315	hsa-miR-552	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT1162317	hsa-miR-559	CLIP-seq
MIRT1162318	hsa-miR-570	CLIP-seq
MIRT1162319	hsa-miR-575	CLIP-seq
MIRT1162320	hsa-miR-583	CLIP-seq
MIRT1162321	hsa-miR-600	CLIP-seq
MIRT1162322	hsa-miR-624	CLIP-seq
MIRT1162323	hsa-miR-633	CLIP-seq
MIRT1162324	hsa-miR-640	CLIP-seq
MIRT1162325	hsa-miR-646	CLIP-seq
MIRT1162326	hsa-miR-661	CLIP-seq
MIRT1162327	hsa-miR-664	CLIP-seq
MIRT1162328	hsa-miR-665	CLIP-seq
MIRT1162329	hsa-miR-764	CLIP-seq
MIRT1556704	hsa-miR-3662	CLIP-seq
MIRT2046502	hsa-miR-1178	CLIP-seq
MIRT2046503	hsa-miR-122	CLIP-seq
MIRT2046504	hsa-miR-1228	CLIP-seq
MIRT2046505	hsa-miR-1270	CLIP-seq
MIRT2046506	hsa-miR-1292	CLIP-seq
MIRT2046507	hsa-miR-129-5p	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT2046508	hsa-miR-146a	CLIP-seq
MIRT2046509	hsa-miR-146b-5p	CLIP-seq
MIRT2046510	hsa-miR-185	CLIP-seq
MIRT2046511	hsa-miR-1915	CLIP-seq
MIRT1162218	hsa-miR-1976	CLIP-seq
MIRT2046512	hsa-miR-2276	CLIP-seq
MIRT2046513	hsa-miR-299-3p	CLIP-seq
MIRT2046514	hsa-miR-3115	CLIP-seq
MIRT2046515	hsa-miR-3149	CLIP-seq
MIRT2046516	hsa-miR-3151	CLIP-seq
MIRT2046517	hsa-miR-3194-3p	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT2046518	hsa-miR-3690	CLIP-seq
MIRT2046519	hsa-miR-377	CLIP-seq
MIRT2046520	hsa-miR-3921	CLIP-seq
MIRT1162253	hsa-miR-3925-5p	CLIP-seq
MIRT2046521	hsa-miR-4254	CLIP-seq
MIRT1162258	hsa-miR-4272	CLIP-seq
MIRT2046522	hsa-miR-4284	CLIP-seq
MIRT2046523	hsa-miR-4306	CLIP-seq
MIRT2046524	hsa-miR-4447	CLIP-seq
MIRT2046525	hsa-miR-4450	CLIP-seq
MIRT2046526	hsa-miR-4471	CLIP-seq
MIRT2046527	hsa-miR-4472	CLIP-seq
MIRT2046528	hsa-miR-4531	CLIP-seq
MIRT2046529	hsa-miR-4644	CLIP-seq
MIRT2046530	hsa-miR-4653-5p	CLIP-seq
MIRT1162272	hsa-miR-4659a-3p	CLIP-seq
MIRT1162273	hsa-miR-4659b-3p	CLIP-seq
MIRT2046531	hsa-miR-4699-3p	CLIP-seq
MIRT2046532	hsa-miR-4726-3p	CLIP-seq
MIRT2046533	hsa-miR-4735-5p	CLIP-seq
MIRT2046534	hsa-miR-4772-3p	CLIP-seq
MIRT2046535	hsa-miR-4775	CLIP-seq
MIRT1162284	hsa-miR-4777-3p	CLIP-seq
MIRT1162287	hsa-miR-4793-5p	CLIP-seq
MIRT1162288	hsa-miR-491-5p	CLIP-seq
MIRT2046536	hsa-miR-513b	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT1162320	hsa-miR-583	CLIP-seq
MIRT2046537	hsa-miR-590-3p	CLIP-seq
MIRT2046538	hsa-miR-620	CLIP-seq
MIRT2046539	hsa-miR-767-3p	CLIP-seq
MIRT2046502	hsa-miR-1178	CLIP-seq
MIRT2275614	hsa-miR-1200	CLIP-seq
MIRT2275615	hsa-miR-1208	CLIP-seq
MIRT2046503	hsa-miR-122	CLIP-seq
MIRT2046504	hsa-miR-1228	CLIP-seq
MIRT2275616	hsa-miR-1243	CLIP-seq
MIRT1162202	hsa-miR-1262	CLIP-seq
MIRT1162203	hsa-miR-1279	CLIP-seq
MIRT1162204	hsa-miR-128	CLIP-seq
MIRT1162205	hsa-miR-1290	CLIP-seq
MIRT2046506	hsa-miR-1292	CLIP-seq
MIRT1162206	hsa-miR-1293	CLIP-seq
MIRT2275617	hsa-miR-1305	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT2275618	hsa-miR-146b-3p	CLIP-seq
MIRT1162210	hsa-miR-1470	CLIP-seq
MIRT1162212	hsa-miR-15a	CLIP-seq
MIRT1162213	hsa-miR-15b	CLIP-seq
MIRT1162214	hsa-miR-16	CLIP-seq
MIRT1162215	hsa-miR-188-3p	CLIP-seq
MIRT2046511	hsa-miR-1915	CLIP-seq
MIRT1162216	hsa-miR-195	CLIP-seq
MIRT1162218	hsa-miR-1976	CLIP-seq
MIRT2275619	hsa-miR-200b	CLIP-seq
MIRT2275620	hsa-miR-200c	CLIP-seq
MIRT2275621	hsa-miR-2052	CLIP-seq
MIRT2275622	hsa-miR-216a	CLIP-seq
MIRT2046512	hsa-miR-2276	CLIP-seq
MIRT1162221	hsa-miR-27a	CLIP-seq
MIRT1162222	hsa-miR-27b	CLIP-seq
MIRT2046513	hsa-miR-299-3p	CLIP-seq
MIRT2275623	hsa-miR-302f	CLIP-seq
MIRT2046514	hsa-miR-3115	CLIP-seq
MIRT1162224	hsa-miR-3123	CLIP-seq
MIRT2275624	hsa-miR-3126-5p	CLIP-seq
MIRT1162225	hsa-miR-3144-5p	CLIP-seq
MIRT2046516	hsa-miR-3151	CLIP-seq
MIRT1162227	hsa-miR-3156-3p	CLIP-seq
MIRT2275625	hsa-miR-3157-3p	CLIP-seq
MIRT2275626	hsa-miR-3173-3p	CLIP-seq
MIRT2275627	hsa-miR-3173-5p	CLIP-seq
MIRT1162232	hsa-miR-3191	CLIP-seq
MIRT1162233	hsa-miR-3199	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT2275628	hsa-miR-342-3p	CLIP-seq
MIRT2275629	hsa-miR-3616-5p	CLIP-seq
MIRT2275630	hsa-miR-3647-5p	CLIP-seq
MIRT2275631	hsa-miR-3654	CLIP-seq
MIRT2275632	hsa-miR-3668	CLIP-seq
MIRT2275633	hsa-miR-3686	CLIP-seq
MIRT2275634	hsa-miR-3692	CLIP-seq
MIRT2275635	hsa-miR-374c	CLIP-seq
MIRT2046519	hsa-miR-377	CLIP-seq
MIRT2275636	hsa-miR-3909	CLIP-seq
MIRT1162252	hsa-miR-3919	CLIP-seq
MIRT1162253	hsa-miR-3925-5p	CLIP-seq
MIRT2275637	hsa-miR-3973	CLIP-seq
MIRT1162256	hsa-miR-424	CLIP-seq
MIRT1162258	hsa-miR-4272	CLIP-seq
MIRT2275638	hsa-miR-4279	CLIP-seq
MIRT2275639	hsa-miR-429	CLIP-seq
MIRT1162261	hsa-miR-4301	CLIP-seq
MIRT1162262	hsa-miR-431	CLIP-seq
MIRT2275640	hsa-miR-4324	CLIP-seq
MIRT2275641	hsa-miR-4330	CLIP-seq
MIRT2275642	hsa-miR-4420	CLIP-seq
MIRT2046524	hsa-miR-4447	CLIP-seq
MIRT2046525	hsa-miR-4450	CLIP-seq
MIRT2046526	hsa-miR-4471	CLIP-seq
MIRT2046527	hsa-miR-4472	CLIP-seq
MIRT1162266	hsa-miR-4483	CLIP-seq
MIRT2275643	hsa-miR-452	CLIP-seq
MIRT2275644	hsa-miR-4522	CLIP-seq
MIRT1162268	hsa-miR-4524	CLIP-seq
MIRT2275645	hsa-miR-4540	CLIP-seq
MIRT2275646	hsa-miR-4635	CLIP-seq
MIRT1162271	hsa-miR-4652-5p	CLIP-seq
MIRT1162276	hsa-miR-4667-3p	CLIP-seq
MIRT2275647	hsa-miR-4676-3p	CLIP-seq
MIRT2275648	hsa-miR-4691-5p	CLIP-seq
MIRT2275649	hsa-miR-4698	CLIP-seq
MIRT1162278	hsa-miR-4701-3p	CLIP-seq
MIRT2275650	hsa-miR-4715-5p	CLIP-seq
MIRT2275651	hsa-miR-4722-3p	CLIP-seq
MIRT2046532	hsa-miR-4726-3p	CLIP-seq
MIRT2275652	hsa-miR-4732-5p	CLIP-seq
MIRT2275653	hsa-miR-4742-3p	CLIP-seq
MIRT2275654	hsa-miR-4756-3p	CLIP-seq
MIRT1162283	hsa-miR-4764-3p	CLIP-seq
MIRT1162284	hsa-miR-4777-3p	CLIP-seq
MIRT2275655	hsa-miR-4779	CLIP-seq
MIRT2275656	hsa-miR-487a	CLIP-seq
MIRT1162288	hsa-miR-491-5p	CLIP-seq
MIRT1162290	hsa-miR-497	CLIP-seq
MIRT2275657	hsa-miR-498	CLIP-seq
MIRT2275658	hsa-miR-499-3p	CLIP-seq
MIRT2275659	hsa-miR-499a-3p	CLIP-seq
MIRT2275660	hsa-miR-501-5p	CLIP-seq
MIRT1162291	hsa-miR-503	CLIP-seq
MIRT2046536	hsa-miR-513b	CLIP-seq
MIRT1162294	hsa-miR-532-3p	CLIP-seq
MIRT2275661	hsa-miR-539	CLIP-seq
MIRT2275662	hsa-miR-544b	CLIP-seq
MIRT2275663	hsa-miR-548k	CLIP-seq
MIRT2275664	hsa-miR-550b	CLIP-seq
MIRT1162315	hsa-miR-552	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT2275665	hsa-miR-573	CLIP-seq
MIRT2275666	hsa-miR-576-3p	CLIP-seq
MIRT1162320	hsa-miR-583	CLIP-seq
MIRT1162325	hsa-miR-646	CLIP-seq
MIRT2275667	hsa-miR-647	CLIP-seq
MIRT2275668	hsa-miR-655	CLIP-seq
MIRT2275669	hsa-miR-873	CLIP-seq
MIRT2275670	hsa-miR-874	CLIP-seq
MIRT1162199	hsa-miR-1193	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT1162218	hsa-miR-1976	CLIP-seq
MIRT1162219	hsa-miR-2392	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT1162324	hsa-miR-640	CLIP-seq
MIRT2275632	hsa-miR-3668	CLIP-seq
MIRT2275637	hsa-miR-3973	CLIP-seq
MIRT2275652	hsa-miR-4732-5p	CLIP-seq
MIRT2275663	hsa-miR-548k	CLIP-seq
MIRT1162205	hsa-miR-1290	CLIP-seq
MIRT2046507	hsa-miR-129-5p	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT2454533	hsa-miR-203	CLIP-seq
MIRT2046515	hsa-miR-3149	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT2454534	hsa-miR-411	CLIP-seq
MIRT2046533	hsa-miR-4735-5p	CLIP-seq
MIRT2046535	hsa-miR-4775	CLIP-seq
MIRT1162288	hsa-miR-491-5p	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT1162320	hsa-miR-583	CLIP-seq
MIRT2046537	hsa-miR-590-3p	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT1162320	hsa-miR-583	CLIP-seq
MIRT2046506	hsa-miR-1292	CLIP-seq
MIRT2046507	hsa-miR-129-5p	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT2046513	hsa-miR-299-3p	CLIP-seq
MIRT2046514	hsa-miR-3115	CLIP-seq
MIRT2046515	hsa-miR-3149	CLIP-seq
MIRT2046516	hsa-miR-3151	CLIP-seq
MIRT1162233	hsa-miR-3199	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT2454534	hsa-miR-411	CLIP-seq
MIRT2046524	hsa-miR-4447	CLIP-seq
MIRT2046525	hsa-miR-4450	CLIP-seq
MIRT2046526	hsa-miR-4471	CLIP-seq
MIRT2046527	hsa-miR-4472	CLIP-seq
MIRT1162272	hsa-miR-4659a-3p	CLIP-seq
MIRT1162273	hsa-miR-4659b-3p	CLIP-seq
MIRT2046533	hsa-miR-4735-5p	CLIP-seq
MIRT2046535	hsa-miR-4775	CLIP-seq
MIRT1162288	hsa-miR-491-5p	CLIP-seq
MIRT1162315	hsa-miR-552	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT1162320	hsa-miR-583	CLIP-seq
MIRT2046537	hsa-miR-590-3p	CLIP-seq
MIRT1162329	hsa-miR-764	CLIP-seq
MIRT2046506	hsa-miR-1292	CLIP-seq
MIRT2046507	hsa-miR-129-5p	CLIP-seq
MIRT1162209	hsa-miR-142-5p	CLIP-seq
MIRT2046513	hsa-miR-299-3p	CLIP-seq
MIRT2046514	hsa-miR-3115	CLIP-seq
MIRT2046515	hsa-miR-3149	CLIP-seq
MIRT2046516	hsa-miR-3151	CLIP-seq
MIRT1162233	hsa-miR-3199	CLIP-seq
MIRT1162235	hsa-miR-340	CLIP-seq
MIRT2454534	hsa-miR-411	CLIP-seq
MIRT2046524	hsa-miR-4447	CLIP-seq
MIRT2046525	hsa-miR-4450	CLIP-seq
MIRT2046526	hsa-miR-4471	CLIP-seq
MIRT2046527	hsa-miR-4472	CLIP-seq
MIRT2046533	hsa-miR-4735-5p	CLIP-seq
MIRT2046535	hsa-miR-4775	CLIP-seq
MIRT1162288	hsa-miR-491-5p	CLIP-seq
MIRT1162315	hsa-miR-552	CLIP-seq
MIRT1162316	hsa-miR-555	CLIP-seq
MIRT1162320	hsa-miR-583	CLIP-seq
MIRT2046537	hsa-miR-590-3p	CLIP-seq
MIRT1162329	hsa-miR-764	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004645	Function	1,4-alpha-oligoglucan phosphorylase activity	TAS	8687427
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006139	Process	Nucleobase-containing compound metabolic process	TAS	8687427
GO:0006166	Process	Purine ribonucleoside salvage	IEA
GO:0006738	Process	Nicotinamide riboside catabolic process	IDA	19001417
GO:0009116	Process	Nucleoside metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016763	Function	Pentosyltransferase activity	IEA
GO:0017061	Function	S-methyl-5-thioadenosine phosphorylase activity	IBA
GO:0017061	Function	S-methyl-5-thioadenosine phosphorylase activity	IEA
GO:0019509	Process	L-methionine salvage from methylthioadenosine	IBA
GO:0019509	Process	L-methionine salvage from methylthioadenosine	IEA
GO:0032259	Process	Methylation	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
156540	7413	ENSG00000099810

Q13126

Protein name

S-methyl-5'-thioadenosine phosphorylase (EC 2.4.2.28) (5'-methylthioadenosine phosphorylase) (MTA phosphorylase) (MTAP) (MTAPase)

Protein function

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the meth

PDB

1CB0 , 1CG6 , 1K27 , 1SD1 , 1SD2 , 3LN5 , 3OZC , 3OZD , 3OZE , 5EUB , 5TC5 , 5TC6 , 5TC7 , 5TC8 , 6DYZ , 6DZ0 , 6DZ2 , 6DZ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01048	PNP_UDP_1	11 → 256	Phosphorylase superfamily	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed.

Sequence

MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR
HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR
PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR
AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH

Sequence length

283

Interactions

View interactions

	KEGG		Reactome
	Cysteine and methionine metabolism Metabolic pathways		Methionine salvage pathway Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Diaphyseal medullary stenosis-bone malignancy syndrome	Pathogenic	rs2131048129, rs2131048008	RCV000022659 RCV000022660	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (39)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIAPHYSEAL MEDULLARY STENOSIS WITH MALIGNANT FIBROUS HISTIOCYTOMA	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial prostate cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hepatocellular carcinoma	Benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPEROPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MTAP-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WET MACULAR DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (182)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphoblastic leukemia with lymphomatous features	Lymphoblastic Leukemia With Lymphomatous Features	BEFREE	3925340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16818274, 21414664, 23040436, 7683574, 8874207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30473463, 31539805, 31774228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15534104, 16224217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15534104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16224217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15534104, 15662124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15492751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	23361049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21414664, 8874207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	12200696, 9426690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20056914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27172220, 33077924, 37032198, 38019246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20056914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16224217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	16373701		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12438261, 26751376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	14506228, 20513530, 22522925, 26751376, 32570693, 36361596, 36913304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17552003, 27929028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35766227	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21412930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21356366, 38330461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	34518040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	23020581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18555557, 21135097, 21282358, 7683574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28720843, 38054349, 38330461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27229762, 35945149, 35979371, 38017544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35747993	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12661005, 16818274, 21414664, 8874207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38330461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16631464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	16631464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23019410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15492751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15492751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23361049, 27433286, 29268653, 38330461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30701095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23462334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21307941, 22664640	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	23462334		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	23462334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21693730, 27761950, 30681428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	GWASCAT_DG	30429480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diaphyseal medullary stenosis with bone malignancy	Diaphyseal Medullary Stenosis With Bone Malignancy	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diaphyseal medullary stenosis with malignant fibrous histiocytoma	Diaphyseal Medullary Stenosis With Malignant Fibrous Histiocytoma	GENOMICS_ENGLAND_DG	22464254		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diaphyseal medullary stenosis with malignant fibrous histiocytoma	Diaphyseal Medullary Stenosis With Malignant Fibrous Histiocytoma	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diaphyseal medullary stenosis with malignant fibrous histiocytoma	Diaphyseal Medullary Stenosis With Malignant Fibrous Histiocytoma	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diaphyseal medullary stenosis-bone malignancy syndrome	Diaphyseal Medullary Stenosis-Bone Malignancy Syndrome	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	34518040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11985785, 9591637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	9623796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27960044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	21131597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24324622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	16224217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	38330461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19887491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19478948, 21649900, 21884817, 26936918, 31533041, 32093414, 33077924, 34244484, 35264604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21884817, 26936918, 31040154, 31533041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26936918, 31040154, 31533041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11126361, 30558563, 31040154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30558563, 32093414, 33077924, 37032198, 38109891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type V	Glycogen storage disease	Pubtator	11985785, 27479139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	35963436	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma	Histiocytoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	38641323	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperchloremia	Hyperchloremia	BEFREE	30473463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	15301428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	30994044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19427650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	Pubtator	18163473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	23040436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30473463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23020581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lentigo maligna melanoma	Lentigo maligna melanoma	BEFREE	21962134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12200696, 23040436, 9426690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15511635, 16081515, 21356366, 7898924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16081515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15511635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	40138743	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19478948, 21282358, 33155773, 35766227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	23040436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15753993, 23040436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	9591637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	9591637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	26872600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	22464254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	16778103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	16778103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of lower limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of upper limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31231127, 31821740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12438261, 26751376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	9623796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18555557, 21135097, 21282358, 7683574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15534104, 15662124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	21716162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22252602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16224217, 21412930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10197619, 11126361, 15492751, 15662124, 15753993, 16631464, 1736901, 17912432, 21131597, 21135097, 21282358, 21412930, 22623710, 23884293, 26872600 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12438261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26751376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16778103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	12875987, 21962134		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12875987, 21693730, 21962134, 23265702, 23361049, 25087184, 25837821, 26909863, 27479139, 27761950, 29317335, 30680790, 30681428, 31794051, 7898924		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	12875987		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	12875987, 20500769	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	15596045, 19578365, 21343389, 21962134, 21983785, 22685558, 23361049, 23393597, 23816148, 25837821, 26909863, 27479139, 29317335, 34724200, 35357426, 37277447 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASCAT_DG	19578364, 21983787, 28212542		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASDB_DG	19578364, 21706340, 21983787		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	19578364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20574843, 21962134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	12796375, 15950811, 20081810, 22394205, 28213009, 29053210, 31231127, 31685964, 31821740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	31821740, 35459788, 35945149, 37295554, 38017544, 38092371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	29053210, 31821740, 33493384, 33795785, 35459788, 35738002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	Pubtator	30994044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	31774228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	26872600	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19272367, 23462334		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26656376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26656376	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10329596, 10803528, 11895909, 12438261, 12875987, 15301428, 15305192, 15492751, 15511635, 15534104, 15662124, 15753993, 15950811, 16224217, 16778103 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15305192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36361596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15534104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	15534104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	31231129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	GWASDB_DG	19578365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	CTD_human_DG	19578365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	21962134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18555557, 9840931		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oligodendroglioma	Oligodendroglioma	Pubtator	37032198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	25271301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25271301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11895909, 17912432, 23361049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19478948	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35430564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15534104		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	15534104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15662124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	40138743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	25365448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	40138743	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	23040436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	38092371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	20081810, 38092371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	36138075	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	29053210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	30429020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	34795367	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16818274, 23040436, 7683574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10197619, 10803528, 11987241, 25917288, 8650244, 8874207, 9815702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile cataract	Presenile Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22252602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	21716162		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34518040	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30701095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	30701095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	3925340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15301428, 30314519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30314519, 32759977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	29243509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	26872600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	26872600	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	26872600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10226521		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	LHGDN	16618910		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26635288, 27960044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34518040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stenosis of the medullary cavity of the long bones	Stenosis of the medullary cavity of the long bones	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	15301428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21412930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17552003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	23040436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36913304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27270441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MTAP (methylthioadenosine phosphorylase)