MT2A (metallothionein 2A)

Gene

• Entrez ID: 4502
• Gene name: Metallothionein 2A
• Gene symbol: MT2A
• Synonyms (NCBI Gene): MT-2, MT-II, MT2
• Chromosome: 16
• Chromosome location: 16q13
• Summary: This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heav

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053519	hsa-miR-23a-3p	Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23553990
MIRT486125	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT486124	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT486123	hsa-miR-553	PAR-CLIP	23592263
MIRT284325	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT284328	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT284327	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT284323	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT284322	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT284324	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT284326	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT486125	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT486124	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT486123	hsa-miR-553	PAR-CLIP	23592263
MIRT284325	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT284328	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT284327	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT284323	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT284322	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT284324	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT284326	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162153	hsa-miR-330-3p	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162153	hsa-miR-330-3p	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Unknown	23994556

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12646258, 12970870, 14550308, 15541360, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006878	Process	Intracellular copper ion homeostasis	TAS	6719135
GO:0006882	Process	Intracellular zinc ion homeostasis	IBA
GO:0008270	Function	Zinc ion binding	ISS
GO:0010273	Process	Detoxification of copper ion	IBA
GO:0036016	Process	Cellular response to interleukin-3	IEP	11168427
GO:0036018	Process	Cellular response to erythropoietin	IEP	11168427
GO:0045926	Process	Negative regulation of growth	ISS
GO:0046872	Function	Metal ion binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0071276	Process	Cellular response to cadmium ion	IBA
GO:0071280	Process	Cellular response to copper ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IEP	11168427

Other IDs

• MIM: 156360
• HGNC: 7406
• e!Ensembl: ENSG00000125148

Protein

• UniProt ID: P02795
• Protein name: Metallothionein-2 (MT-2) (Metallothionein-2A) (Metallothionein-II) (MT-II)
• Protein function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• PDB: 1MHU, 2MHU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00131	Metallothio	1 → 61	Metallothionein	Domain

• Sequence:

  MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC
  A

• Sequence length: 61

Pathways

KEGG:

Mineral absorption

Reactome:

Metallothioneins bind metals
Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID STENOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC INTRAEPITHELIAL NEOPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
3 beta-Hydroxysteroid dehydrogenase deficiency	3 beta-hydroxysteroid dehydrogenase deficiency	BEFREE	12050213		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	10715376, 28635422		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17213040, 30124448	Associate	★☆☆☆☆ Found in Text Mining only
Amblyopia	Amblyopia	Pubtator	10803406	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	11298796		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	21480980, 25257530, 27314307		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16518702, 17622311, 24560278		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39321281	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	30932010	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16518702, 17622311, 24560278		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36077244	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11270423		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	16565513, 7729958		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	28228606	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	26036762	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11756227, 21187089, 21792883, 23053628, 26093198, 28228606, 9694254		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14578200, 20652934, 21187089, 23053628, 28228606, 35650297	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	15583813		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23870553	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23042264	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35650297	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	31936364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11270423		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24952512, 25157674		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24763884	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30466987	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	17622311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Stenosis	Carotid artery stenosis	LHGDN	17622311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Stenosis	Carotid artery stenosis	Pubtator	17622311	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	Pubtator	14551530	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17622311		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27122239		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	CTD_human_DG	27122239		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	CTD_human_DG	27122239		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	31019305	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	11077043		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30466987	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24452846		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22426038		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	28507149		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28061540, 28604612	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25555862		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25555862		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25555862	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25555862	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25555862		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19603079		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19603079	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19708722, 21353709		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31321953	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17622311, 18349110, 27122239, 29464840		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17622311, 18349110, 27122239, 29464840		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	17622311, 27122239	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	27122239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18349110	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16518702, 23148893, 23798576, 29637854, 31624901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	31540037		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31540037, 35741790	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	23053628		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	30466987	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28382516		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36232817	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	23028585, 31321953	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12646258		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12646258		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	12646258		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37027423	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36466860	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	36060520	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	21235001, 23986211	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30932010	Stimulate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	30932010	Stimulate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	26036762	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	16144979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	14503839		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	9694254		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16518702		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31624901		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30466987	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27216938	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	30466987	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23870553	Inhibit	★☆☆☆☆ Found in Text Mining only
Juvenile hemochromatosis	Hemochromatosis	BEFREE	25588876		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34437439	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36981043	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34220318	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	17363595, 28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25768320		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35650297	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23947958, 35650297	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18601746		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	18601746		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19708722		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11756227, 21187089, 21792883, 23053628, 26093198, 28228606, 9694254		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28382516		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12646258		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24952512, 25157674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	15583813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11807957, 22824183, 23064315, 23466427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16574721, 17914565		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	14503839		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15701830, 23553990, 23876896, 26801633, 30301827		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11270423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	16565513, 7729958		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11807957, 26801633, 29854276		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22426038		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11888668, 21187089		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19708722, 21353709		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33122816	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30466987	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	31019305	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33340085	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	2873080		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15725085	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30543238		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	2464283	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15583813		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16549050	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12646258, 19838947, 24952512, 26036762, 26801633, 28228606, 28507149, 28507478, 31444479		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	18601746		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	18349110	Associate	★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	28870952		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16672770		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	28512916		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24157868, 31444479		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24157868	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26579577	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34072023	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28870952		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	26036762	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20110911		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31540037		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	31540037	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	32340109	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11807957, 22824183, 23064315, 23466427		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	18208603		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	18208603	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	CTD_human_DG	16574721		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14550308, 17914565		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16574721, 17914565		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18208603, 35650297	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	18992145	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	9926163	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	21353709		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	PSYGENET_DG	21353709		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23028585	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30706174		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	23971978, 28382516		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26666815, 33340085	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status epilepticus	Pubtator	23028585	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15701830, 23553990, 23876896, 26801633, 30301827		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	14503839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	21235001, 31380415, 35650297, 36060520	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	23870553	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	17485079	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	17622311		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	17622311		★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group B	Xeroderma Pigmentosum	BEFREE	11077043		★☆☆☆☆ Found in Text Mining only