MST1 (macrophage stimulating 1)

Gene

• Entrez ID: 4485
• Gene name: Macrophage stimulating 1
• Gene symbol: MST1
• Synonyms (NCBI Gene): D3F15S2, DNF15S2, HGFL, MSP, NF15S2
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025230	hsa-miR-34a-5p	Proteomics	21566225
MIRT025230	hsa-miR-34a-5p	Proteomics	21566225
MIRT735859	hsa-miR-1184	Western blotting, qRT-PCR	32681581
MIRT735859	hsa-miR-1184	Western blotting, Immunoprecipitaion (IP), qRT-PCR	32681581

Transcription factors

Transcription factor	Regulation	Reference
EZH2	Repression	24499724
MYC	Repression	24499724

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IBA
GO:0005515	Function	Protein binding	IPI	22087277, 25193665, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	7508914
GO:0006508	Process	Proteolysis	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IDA	22087277
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	19720831
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:2000479	Process	Regulation of cAMP-dependent protein kinase activity	IDA	19720831

Other IDs

• MIM: 142408
• HGNC: 7380
• e!Ensembl: ENSG00000173531

Protein

• UniProt ID: P26927
• Protein name: Hepatocyte growth factor-like protein (Macrophage stimulatory protein) (Macrophage-stimulating protein) (MSP) [Cleaved into: Hepatocyte growth factor-like protein alpha chain; Hepatocyte growth factor-like protein beta chain]
• PDB: 2ASU, 4QT8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00024	PAN_1	16 → 106	PAN domain	Domain
  PF00051	Kringle	110 → 186	Kringle domain	Domain
  PF00051	Kringle	191 → 268	Kringle domain	Domain
  PF00051	Kringle	283 → 361	Kringle domain	Domain
  PF00051	Kringle	370 → 448	Kringle domain	Domain
  PF00089	Trypsin	484 → 704	Trypsin	Domain

• Sequence:

  MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
  GPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG
  TMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQS
  CGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYC
  RNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTA
  GVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRR
  CTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCR
  NPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRS
  KLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGT
  LFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT
  KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGD
  YGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG

• Sequence length: 711

Pathways

KEGG:

Calcium signaling pathway

Reactome:

Signaling by MST1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGITIS, SCLEROSING	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DUE TO STK4 DEFICIENCY	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPIDERMODYSPLASIA VERRUCIFORMIS	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 110 WITH LYMPHOPROLIFERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations