MSRA (methionine sulfoxide reductase A)

Gene

• Entrez ID: 4482
• Gene name: Methionine sulfoxide reductase A
• Gene symbol: MSRA
• Synonyms (NCBI Gene): PMSR
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein func

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022647	hsa-miR-124-3p	Microarray	18668037
MIRT1161808	hsa-miR-1228	CLIP-seq
MIRT1161809	hsa-miR-198	CLIP-seq
MIRT1161810	hsa-miR-338-3p	CLIP-seq
MIRT1161811	hsa-miR-342-3p	CLIP-seq
MIRT1161812	hsa-miR-361-3p	CLIP-seq
MIRT1161813	hsa-miR-4267	CLIP-seq
MIRT1161814	hsa-miR-4421	CLIP-seq
MIRT1161815	hsa-miR-4530	CLIP-seq
MIRT1161816	hsa-miR-4793-5p	CLIP-seq
MIRT1161817	hsa-miR-615-5p	CLIP-seq
MIRT1161818	hsa-miR-330-3p	CLIP-seq
MIRT1161819	hsa-miR-4422	CLIP-seq
MIRT1161820	hsa-miR-4760-3p	CLIP-seq
MIRT2275499	hsa-miR-224	CLIP-seq
MIRT2275500	hsa-miR-23a	CLIP-seq
MIRT2275501	hsa-miR-23b	CLIP-seq
MIRT2275502	hsa-miR-23c	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006555	Process	Methionine metabolic process	TAS	10452521
GO:0006979	Process	Response to oxidative stress	TAS	10452521
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	IBA
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	IEA
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	TAS	10452521
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030091	Process	Protein repair	TAS
GO:0033744	Function	L-methionine:thioredoxin-disulfide S-oxidoreductase activity	IEA
GO:0034599	Process	Cellular response to oxidative stress	IBA
GO:0036211	Process	Protein modification process	TAS	10452521
GO:0036456	Function	L-methionine-(S)-S-oxide reductase activity	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 601250
• HGNC: 7377
• e!Ensembl: ENSG00000175806

Protein

• UniProt ID: Q9UJ68
• Protein name: Mitochondrial peptide methionine sulfoxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) (Protein-methionine-S-oxide reductase) (PMSR)
• Protein function: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01625	PMSR	67 → 221	Peptide methionine sulfoxide reductase	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
• Sequence:

  MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEP
  FPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVR
  VVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQ
  KVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

• Sequence length: 235

Pathways

Reactome:

Protein repair

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BULIMIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITRAL VALVE PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MSRA-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	30650190		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	GWASCAT_DG	27527254		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10501213	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26318157, 26410585		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20617525	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26318157, 26410585		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	24030498		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	GWASCAT_DG	27527254		★☆☆☆☆ Found in Text Mining only
Bipolar I disorder	Bipolar Disorder	BEFREE	26117066		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20937881, 26289382		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17784942	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35752173	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22657383, 26318157, 26410585		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	33578567	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	15199188	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	19461988		★☆☆☆☆ Found in Text Mining only
Chronic obstructive asthma (with obstructive pulmonary disease)	Asthma	GWASCAT_DG	30657218		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27256292	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22657383, 23880405		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23880405		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23880405		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22438829		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	27256292	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	BEFREE	26318157		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26318157		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	28882999		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17784942		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29559929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	20937881, 26289382		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27321817		★☆☆☆☆ Found in Text Mining only
Meconium ileus	Meconium ileus	BEFREE	22438829		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22081025		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	22657383		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20937881		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20060866		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18032652		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	28552732		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30650190		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20421936, 21674055, 21796137, 24670271, 26828654		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21674055, 22095114, 26828654, 27421018	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18032652, 31775527		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	22095114		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33578567	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34674978	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20617525, 22657383, 23244167		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18506707, 21679298, 31775527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18506707, 21679298		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260, 31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	26318157		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	GWASCAT_DG	29559929		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	26449752		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	LHGDN	17943184		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	17943184	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19558554		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19558554		★☆☆☆☆ Found in Text Mining only