MSI1 (musashi RNA binding protein 1)

Gene

• Entrez ID: 4440
• Gene name: Musashi RNA binding protein 1
• Gene symbol: MSI1
• Synonyms (NCBI Gene): -
• Chromosome: 12
• Chromosome location: 12q24.31
• Summary: This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052295	hsa-let-7b-5p	CLASH	23622248
MIRT048066	hsa-miR-197-3p	CLASH	23622248
MIRT649997	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT649996	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT649995	hsa-miR-4719	HITS-CLIP	23824327
MIRT649994	hsa-miR-3175	HITS-CLIP	23824327
MIRT649993	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT649992	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT491088	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT649991	hsa-miR-2110	HITS-CLIP	23824327
MIRT649989	hsa-miR-6810-5p	HITS-CLIP	23824327
MIRT649990	hsa-miR-3150a-3p	HITS-CLIP	23824327
MIRT649987	hsa-miR-6763-5p	HITS-CLIP	23824327
MIRT649988	hsa-miR-6857-5p	HITS-CLIP	23824327
MIRT649986	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT649985	hsa-miR-4260	HITS-CLIP	23824327
MIRT649984	hsa-miR-5572	HITS-CLIP	23824327
MIRT649997	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT649996	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT649995	hsa-miR-4719	HITS-CLIP	23824327
MIRT649994	hsa-miR-3175	HITS-CLIP	23824327
MIRT649993	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT649992	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT491088	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT649991	hsa-miR-2110	HITS-CLIP	23824327
MIRT649989	hsa-miR-6810-5p	HITS-CLIP	23824327
MIRT649990	hsa-miR-3150a-3p	HITS-CLIP	23824327
MIRT649987	hsa-miR-6763-5p	HITS-CLIP	23824327
MIRT649988	hsa-miR-6857-5p	HITS-CLIP	23824327
MIRT649986	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT649985	hsa-miR-4260	HITS-CLIP	23824327
MIRT649984	hsa-miR-5572	HITS-CLIP	23824327
MIRT491102	hsa-miR-6805-5p	PAR-CLIP	24398324
MIRT491103	hsa-miR-1205	PAR-CLIP	24398324
MIRT491101	hsa-miR-6132	PAR-CLIP	24398324
MIRT491100	hsa-miR-6836-5p	PAR-CLIP	24398324
MIRT491099	hsa-miR-1909-3p	PAR-CLIP	24398324
MIRT491098	hsa-miR-6722-3p	PAR-CLIP	24398324
MIRT491097	hsa-miR-3960	PAR-CLIP	24398324
MIRT491096	hsa-miR-8072	PAR-CLIP	24398324
MIRT491095	hsa-miR-4467	PAR-CLIP	24398324
MIRT491093	hsa-miR-604	PAR-CLIP	24398324
MIRT491094	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT491092	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT491091	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT491090	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT491088	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT500169	hsa-miR-3180	PAR-CLIP	24398324
MIRT500168	hsa-miR-3180-3p	PAR-CLIP	24398324
MIRT500166	hsa-miR-3196	PAR-CLIP	24398324
MIRT500167	hsa-miR-6816-5p	PAR-CLIP	24398324
MIRT491089	hsa-miR-1237-5p	PAR-CLIP	24398324
MIRT491087	hsa-miR-4488	PAR-CLIP	24398324
MIRT491086	hsa-miR-4697-5p	PAR-CLIP	24398324
MIRT491102	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT491103	hsa-miR-1205	PAR-CLIP	23592263
MIRT491101	hsa-miR-6132	PAR-CLIP	23592263
MIRT491100	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT491099	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT491098	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT491097	hsa-miR-3960	PAR-CLIP	23592263
MIRT491096	hsa-miR-8072	PAR-CLIP	23592263
MIRT491095	hsa-miR-4467	PAR-CLIP	23592263
MIRT491093	hsa-miR-604	PAR-CLIP	23592263
MIRT491094	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491092	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491091	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491090	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491088	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491089	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT491087	hsa-miR-4488	PAR-CLIP	23592263
MIRT491086	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT733125	hsa-miR-330-3p	Luciferase reporter assay, qRT-PCR, Western blot	27904681
MIRT733125	hsa-miR-330-3p	Luciferase reporter assay, qRT-PCR, Western blot	27904681
MIRT733125	hsa-miR-330-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32801889
MIRT649997	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT649996	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT649995	hsa-miR-4719	HITS-CLIP	23824327
MIRT649994	hsa-miR-3175	HITS-CLIP	23824327
MIRT649993	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT649992	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT491088	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT649991	hsa-miR-2110	HITS-CLIP	23824327
MIRT649989	hsa-miR-6810-5p	HITS-CLIP	23824327
MIRT649990	hsa-miR-3150a-3p	HITS-CLIP	23824327
MIRT649987	hsa-miR-6763-5p	HITS-CLIP	23824327
MIRT649988	hsa-miR-6857-5p	HITS-CLIP	23824327
MIRT649986	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT649985	hsa-miR-4260	HITS-CLIP	23824327
MIRT649984	hsa-miR-5572	HITS-CLIP	23824327
MIRT649997	hsa-miR-501-3p	HITS-CLIP	23824327
MIRT649996	hsa-miR-502-3p	HITS-CLIP	23824327
MIRT649995	hsa-miR-4719	HITS-CLIP	23824327
MIRT649994	hsa-miR-3175	HITS-CLIP	23824327
MIRT649993	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT649992	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT491088	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT649991	hsa-miR-2110	HITS-CLIP	23824327
MIRT649989	hsa-miR-6810-5p	HITS-CLIP	23824327
MIRT649990	hsa-miR-3150a-3p	HITS-CLIP	23824327
MIRT649987	hsa-miR-6763-5p	HITS-CLIP	23824327
MIRT649988	hsa-miR-6857-5p	HITS-CLIP	23824327
MIRT649986	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT649985	hsa-miR-4260	HITS-CLIP	23824327
MIRT649984	hsa-miR-5572	HITS-CLIP	23824327
MIRT491102	hsa-miR-6805-5p	PAR-CLIP	24398324
MIRT491103	hsa-miR-1205	PAR-CLIP	24398324
MIRT491101	hsa-miR-6132	PAR-CLIP	24398324
MIRT491100	hsa-miR-6836-5p	PAR-CLIP	24398324
MIRT491099	hsa-miR-1909-3p	PAR-CLIP	24398324
MIRT491098	hsa-miR-6722-3p	PAR-CLIP	24398324
MIRT491097	hsa-miR-3960	PAR-CLIP	24398324
MIRT491096	hsa-miR-8072	PAR-CLIP	24398324
MIRT491095	hsa-miR-4467	PAR-CLIP	24398324
MIRT491093	hsa-miR-604	PAR-CLIP	24398324
MIRT491094	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT491092	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT491091	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT491090	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT491088	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT500169	hsa-miR-3180	PAR-CLIP	24398324
MIRT500168	hsa-miR-3180-3p	PAR-CLIP	24398324
MIRT500166	hsa-miR-3196	PAR-CLIP	24398324
MIRT500167	hsa-miR-6816-5p	PAR-CLIP	24398324
MIRT491089	hsa-miR-1237-5p	PAR-CLIP	24398324
MIRT491087	hsa-miR-4488	PAR-CLIP	24398324
MIRT491086	hsa-miR-4697-5p	PAR-CLIP	24398324
MIRT491102	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT491103	hsa-miR-1205	PAR-CLIP	23592263
MIRT491101	hsa-miR-6132	PAR-CLIP	23592263
MIRT491100	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT491099	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT491098	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT491097	hsa-miR-3960	PAR-CLIP	23592263
MIRT491096	hsa-miR-8072	PAR-CLIP	23592263
MIRT491095	hsa-miR-4467	PAR-CLIP	23592263
MIRT491093	hsa-miR-604	PAR-CLIP	23592263
MIRT491094	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491092	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491091	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491090	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491088	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491089	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT491087	hsa-miR-4488	PAR-CLIP	23592263
MIRT491086	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT1161225	hsa-miR-101	CLIP-seq
MIRT1161226	hsa-miR-1180	CLIP-seq
MIRT1161227	hsa-miR-1225-3p	CLIP-seq
MIRT1161228	hsa-miR-1236	CLIP-seq
MIRT1161229	hsa-miR-1249	CLIP-seq
MIRT1161230	hsa-miR-1253	CLIP-seq
MIRT1161231	hsa-miR-125a-5p	CLIP-seq
MIRT1161232	hsa-miR-125b	CLIP-seq
MIRT1161233	hsa-miR-1260	CLIP-seq
MIRT1161234	hsa-miR-1260b	CLIP-seq
MIRT1161235	hsa-miR-1266	CLIP-seq
MIRT1161236	hsa-miR-1270	CLIP-seq
MIRT1161237	hsa-miR-128	CLIP-seq
MIRT1161238	hsa-miR-1285	CLIP-seq
MIRT1161239	hsa-miR-1301	CLIP-seq
MIRT1161240	hsa-miR-1303	CLIP-seq
MIRT1161241	hsa-miR-1321	CLIP-seq
MIRT1161242	hsa-miR-139-3p	CLIP-seq
MIRT1161243	hsa-miR-144	CLIP-seq
MIRT1161244	hsa-miR-185	CLIP-seq
MIRT1161245	hsa-miR-188-3p	CLIP-seq
MIRT1161246	hsa-miR-1909	CLIP-seq
MIRT1161247	hsa-miR-191	CLIP-seq
MIRT1161248	hsa-miR-193a-5p	CLIP-seq
MIRT1161249	hsa-miR-196a	CLIP-seq
MIRT1161250	hsa-miR-196b	CLIP-seq
MIRT1161251	hsa-miR-198	CLIP-seq
MIRT1161252	hsa-miR-2117	CLIP-seq
MIRT1161253	hsa-miR-27a	CLIP-seq
MIRT1161254	hsa-miR-27b	CLIP-seq
MIRT1161255	hsa-miR-299-3p	CLIP-seq
MIRT1161256	hsa-miR-3121-5p	CLIP-seq
MIRT1161257	hsa-miR-3123	CLIP-seq
MIRT1161258	hsa-miR-3127-5p	CLIP-seq
MIRT1161259	hsa-miR-3151	CLIP-seq
MIRT1161260	hsa-miR-3156-3p	CLIP-seq
MIRT1161261	hsa-miR-3160-5p	CLIP-seq
MIRT1161262	hsa-miR-3162-5p	CLIP-seq
MIRT1161263	hsa-miR-3163	CLIP-seq
MIRT1161264	hsa-miR-3170	CLIP-seq
MIRT1161265	hsa-miR-3173-5p	CLIP-seq
MIRT1161266	hsa-miR-3184	CLIP-seq
MIRT1161267	hsa-miR-3187-5p	CLIP-seq
MIRT1161268	hsa-miR-331-3p	CLIP-seq
MIRT1161269	hsa-miR-338-3p	CLIP-seq
MIRT1161270	hsa-miR-3647-3p	CLIP-seq
MIRT1161271	hsa-miR-3662	CLIP-seq
MIRT1161272	hsa-miR-3664-3p	CLIP-seq
MIRT1161273	hsa-miR-3679-3p	CLIP-seq
MIRT1161274	hsa-miR-371-5p	CLIP-seq
MIRT1161275	hsa-miR-377	CLIP-seq
MIRT1161276	hsa-miR-3918	CLIP-seq
MIRT1161277	hsa-miR-3927	CLIP-seq
MIRT1161278	hsa-miR-423-5p	CLIP-seq
MIRT1161279	hsa-miR-4264	CLIP-seq
MIRT1161280	hsa-miR-4273	CLIP-seq
MIRT1161281	hsa-miR-4292	CLIP-seq
MIRT1161282	hsa-miR-4306	CLIP-seq
MIRT1161283	hsa-miR-4319	CLIP-seq
MIRT1161284	hsa-miR-4323	CLIP-seq
MIRT1161285	hsa-miR-4324	CLIP-seq
MIRT1161286	hsa-miR-4329	CLIP-seq
MIRT1161287	hsa-miR-4421	CLIP-seq
MIRT1161288	hsa-miR-4424	CLIP-seq
MIRT1161289	hsa-miR-4446-3p	CLIP-seq
MIRT1161290	hsa-miR-4447	CLIP-seq
MIRT1161291	hsa-miR-4472	CLIP-seq
MIRT1161292	hsa-miR-4491	CLIP-seq
MIRT1161293	hsa-miR-4497	CLIP-seq
MIRT1161294	hsa-miR-4518	CLIP-seq
MIRT1161295	hsa-miR-4519	CLIP-seq
MIRT1161296	hsa-miR-4530	CLIP-seq
MIRT1161297	hsa-miR-4531	CLIP-seq
MIRT1161298	hsa-miR-4644	CLIP-seq
MIRT1161299	hsa-miR-4649-3p	CLIP-seq
MIRT1161300	hsa-miR-4651	CLIP-seq
MIRT1161301	hsa-miR-4656	CLIP-seq
MIRT1161302	hsa-miR-4657	CLIP-seq
MIRT1161303	hsa-miR-4660	CLIP-seq
MIRT1161304	hsa-miR-4664-3p	CLIP-seq
MIRT1161305	hsa-miR-4685-5p	CLIP-seq
MIRT1161306	hsa-miR-4699-3p	CLIP-seq
MIRT1161307	hsa-miR-4714-3p	CLIP-seq
MIRT1161308	hsa-miR-4723-5p	CLIP-seq
MIRT1161309	hsa-miR-4731-5p	CLIP-seq
MIRT1161310	hsa-miR-4732-3p	CLIP-seq
MIRT1161311	hsa-miR-4739	CLIP-seq
MIRT1161312	hsa-miR-4749-3p	CLIP-seq
MIRT1161313	hsa-miR-4753-3p	CLIP-seq
MIRT1161314	hsa-miR-4756-5p	CLIP-seq
MIRT1161315	hsa-miR-4764-3p	CLIP-seq
MIRT1161316	hsa-miR-4797-3p	CLIP-seq
MIRT1161317	hsa-miR-491-5p	CLIP-seq
MIRT1161318	hsa-miR-495	CLIP-seq
MIRT1161319	hsa-miR-499-3p	CLIP-seq
MIRT1161320	hsa-miR-499a-3p	CLIP-seq
MIRT1161321	hsa-miR-5047	CLIP-seq
MIRT1161322	hsa-miR-515-5p	CLIP-seq
MIRT1161323	hsa-miR-541	CLIP-seq
MIRT1161324	hsa-miR-548aa	CLIP-seq
MIRT1161325	hsa-miR-548ac	CLIP-seq
MIRT1161326	hsa-miR-548ae	CLIP-seq
MIRT1161327	hsa-miR-548aj	CLIP-seq
MIRT1161328	hsa-miR-548am	CLIP-seq
MIRT1161329	hsa-miR-548c-3p	CLIP-seq
MIRT1161330	hsa-miR-548d-3p	CLIP-seq
MIRT1161331	hsa-miR-548x	CLIP-seq
MIRT1161332	hsa-miR-548z	CLIP-seq
MIRT1161333	hsa-miR-576-3p	CLIP-seq
MIRT1161334	hsa-miR-599	CLIP-seq
MIRT1161335	hsa-miR-608	CLIP-seq
MIRT1161336	hsa-miR-612	CLIP-seq
MIRT1161337	hsa-miR-618	CLIP-seq
MIRT1161338	hsa-miR-620	CLIP-seq
MIRT1161339	hsa-miR-654-5p	CLIP-seq
MIRT1161340	hsa-miR-662	CLIP-seq
MIRT1161341	hsa-miR-670	CLIP-seq
MIRT1161342	hsa-miR-769-5p	CLIP-seq
MIRT1161343	hsa-miR-802	CLIP-seq
MIRT1161344	hsa-miR-939	CLIP-seq
MIRT1161345	hsa-miR-942	CLIP-seq
MIRT1161226	hsa-miR-1180	CLIP-seq
MIRT2046267	hsa-miR-1193	CLIP-seq
MIRT2046268	hsa-miR-1207-5p	CLIP-seq
MIRT2046269	hsa-miR-1234	CLIP-seq
MIRT2046270	hsa-miR-1275	CLIP-seq
MIRT1161237	hsa-miR-128	CLIP-seq
MIRT1161241	hsa-miR-1321	CLIP-seq
MIRT1161243	hsa-miR-144	CLIP-seq
MIRT2046271	hsa-miR-149	CLIP-seq
MIRT2046272	hsa-miR-1538	CLIP-seq
MIRT1161246	hsa-miR-1909	CLIP-seq
MIRT2046273	hsa-miR-214	CLIP-seq
MIRT1161253	hsa-miR-27a	CLIP-seq
MIRT1161254	hsa-miR-27b	CLIP-seq
MIRT2046274	hsa-miR-3147	CLIP-seq
MIRT2046275	hsa-miR-3154	CLIP-seq
MIRT1161264	hsa-miR-3170	CLIP-seq
MIRT2046276	hsa-miR-3179	CLIP-seq
MIRT2046277	hsa-miR-3183	CLIP-seq
MIRT1161266	hsa-miR-3184	CLIP-seq
MIRT1161268	hsa-miR-331-3p	CLIP-seq
MIRT2046278	hsa-miR-342-5p	CLIP-seq
MIRT2046279	hsa-miR-3619-5p	CLIP-seq
MIRT2046280	hsa-miR-3656	CLIP-seq
MIRT1161275	hsa-miR-377	CLIP-seq
MIRT1161276	hsa-miR-3918	CLIP-seq
MIRT1161278	hsa-miR-423-5p	CLIP-seq
MIRT2046281	hsa-miR-4259	CLIP-seq
MIRT2046282	hsa-miR-4317	CLIP-seq
MIRT2046283	hsa-miR-4425	CLIP-seq
MIRT2046284	hsa-miR-4436b-3p	CLIP-seq
MIRT1161289	hsa-miR-4446-3p	CLIP-seq
MIRT1161290	hsa-miR-4447	CLIP-seq
MIRT2046285	hsa-miR-4450	CLIP-seq
MIRT1161291	hsa-miR-4472	CLIP-seq
MIRT1161293	hsa-miR-4497	CLIP-seq
MIRT2046286	hsa-miR-4532	CLIP-seq
MIRT2046287	hsa-miR-4539	CLIP-seq
MIRT1161299	hsa-miR-4649-3p	CLIP-seq
MIRT1161300	hsa-miR-4651	CLIP-seq
MIRT1161304	hsa-miR-4664-3p	CLIP-seq
MIRT2046288	hsa-miR-4664-5p	CLIP-seq
MIRT2046289	hsa-miR-4665-5p	CLIP-seq
MIRT2046290	hsa-miR-4667-5p	CLIP-seq
MIRT1161305	hsa-miR-4685-5p	CLIP-seq
MIRT1161306	hsa-miR-4699-3p	CLIP-seq
MIRT2046291	hsa-miR-4700-3p	CLIP-seq
MIRT2046292	hsa-miR-4700-5p	CLIP-seq
MIRT2046293	hsa-miR-4723-3p	CLIP-seq
MIRT1161311	hsa-miR-4739	CLIP-seq
MIRT2046294	hsa-miR-4745-3p	CLIP-seq
MIRT1161314	hsa-miR-4756-5p	CLIP-seq
MIRT2046295	hsa-miR-4763-3p	CLIP-seq
MIRT1161315	hsa-miR-4764-3p	CLIP-seq
MIRT2046296	hsa-miR-486-3p	CLIP-seq
MIRT1161317	hsa-miR-491-5p	CLIP-seq
MIRT2046297	hsa-miR-493	CLIP-seq
MIRT1161319	hsa-miR-499-3p	CLIP-seq
MIRT1161320	hsa-miR-499a-3p	CLIP-seq
MIRT1161322	hsa-miR-515-5p	CLIP-seq
MIRT1161323	hsa-miR-541	CLIP-seq
MIRT2046298	hsa-miR-548q	CLIP-seq
MIRT2046299	hsa-miR-571	CLIP-seq
MIRT1161335	hsa-miR-608	CLIP-seq
MIRT1161337	hsa-miR-618	CLIP-seq
MIRT2046300	hsa-miR-637	CLIP-seq
MIRT1161339	hsa-miR-654-5p	CLIP-seq
MIRT2046301	hsa-miR-761	CLIP-seq
MIRT1161344	hsa-miR-939	CLIP-seq
MIRT2275386	hsa-miR-1200	CLIP-seq
MIRT1161227	hsa-miR-1225-3p	CLIP-seq
MIRT2275387	hsa-miR-1233	CLIP-seq
MIRT1161237	hsa-miR-128	CLIP-seq
MIRT1161241	hsa-miR-1321	CLIP-seq
MIRT1161243	hsa-miR-144	CLIP-seq
MIRT1161247	hsa-miR-191	CLIP-seq
MIRT1161253	hsa-miR-27a	CLIP-seq
MIRT1161254	hsa-miR-27b	CLIP-seq
MIRT1161266	hsa-miR-3184	CLIP-seq
MIRT1161268	hsa-miR-331-3p	CLIP-seq
MIRT2046278	hsa-miR-342-5p	CLIP-seq
MIRT2275388	hsa-miR-3619-3p	CLIP-seq
MIRT2046280	hsa-miR-3656	CLIP-seq
MIRT1161278	hsa-miR-423-5p	CLIP-seq
MIRT1161285	hsa-miR-4324	CLIP-seq
MIRT2275389	hsa-miR-4419a	CLIP-seq
MIRT1161289	hsa-miR-4446-3p	CLIP-seq
MIRT2046285	hsa-miR-4450	CLIP-seq
MIRT2275390	hsa-miR-4468	CLIP-seq
MIRT2275391	hsa-miR-4492	CLIP-seq
MIRT2275392	hsa-miR-4498	CLIP-seq
MIRT2275393	hsa-miR-4505	CLIP-seq
MIRT2275394	hsa-miR-4510	CLIP-seq
MIRT1161300	hsa-miR-4651	CLIP-seq
MIRT2046288	hsa-miR-4664-5p	CLIP-seq
MIRT1161305	hsa-miR-4685-5p	CLIP-seq
MIRT1161306	hsa-miR-4699-3p	CLIP-seq
MIRT2275395	hsa-miR-4721	CLIP-seq
MIRT1161309	hsa-miR-4731-5p	CLIP-seq
MIRT1161311	hsa-miR-4739	CLIP-seq
MIRT1161314	hsa-miR-4756-5p	CLIP-seq
MIRT2275396	hsa-miR-4776-5p	CLIP-seq
MIRT1161317	hsa-miR-491-5p	CLIP-seq
MIRT1161319	hsa-miR-499-3p	CLIP-seq
MIRT1161320	hsa-miR-499a-3p	CLIP-seq
MIRT1161323	hsa-miR-541	CLIP-seq
MIRT2275397	hsa-miR-544b	CLIP-seq
MIRT2046298	hsa-miR-548q	CLIP-seq
MIRT1161335	hsa-miR-608	CLIP-seq
MIRT1161339	hsa-miR-654-5p	CLIP-seq
MIRT2275398	hsa-miR-762	CLIP-seq
MIRT1161266	hsa-miR-3184	CLIP-seq
MIRT2046280	hsa-miR-3656	CLIP-seq
MIRT1161278	hsa-miR-423-5p	CLIP-seq
MIRT2046285	hsa-miR-4450	CLIP-seq
MIRT1161317	hsa-miR-491-5p	CLIP-seq
MIRT1161229	hsa-miR-1249	CLIP-seq
MIRT1161242	hsa-miR-139-3p	CLIP-seq
MIRT2438802	hsa-miR-1913	CLIP-seq
MIRT2438803	hsa-miR-2861	CLIP-seq
MIRT1161256	hsa-miR-3121-5p	CLIP-seq
MIRT1161261	hsa-miR-3160-5p	CLIP-seq
MIRT1161266	hsa-miR-3184	CLIP-seq
MIRT2438804	hsa-miR-324-3p	CLIP-seq
MIRT1161268	hsa-miR-331-3p	CLIP-seq
MIRT2438805	hsa-miR-346	CLIP-seq
MIRT1161273	hsa-miR-3679-3p	CLIP-seq
MIRT1161278	hsa-miR-423-5p	CLIP-seq
MIRT2438806	hsa-miR-4290	CLIP-seq
MIRT1161281	hsa-miR-4292	CLIP-seq
MIRT2438807	hsa-miR-4527	CLIP-seq
MIRT2438808	hsa-miR-615-5p	CLIP-seq
MIRT1161266	hsa-miR-3184	CLIP-seq
MIRT2046280	hsa-miR-3656	CLIP-seq
MIRT1161278	hsa-miR-423-5p	CLIP-seq
MIRT2046285	hsa-miR-4450	CLIP-seq
MIRT1161317	hsa-miR-491-5p	CLIP-seq
MIRT1161266	hsa-miR-3184	CLIP-seq
MIRT2046280	hsa-miR-3656	CLIP-seq
MIRT1161278	hsa-miR-423-5p	CLIP-seq
MIRT2046285	hsa-miR-4450	CLIP-seq
MIRT1161317	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	9790759
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	30367664, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006417	Process	Regulation of translation	IBA
GO:0007399	Process	Nervous system development	TAS	9790759
GO:0007417	Process	Central nervous system development	IBA
GO:0008266	Function	Poly(U) RNA binding	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	30367664
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0140693	Function	Molecular condensate scaffold activity	IEA

Other IDs

• MIM: 603328
• HGNC: 7330
• e!Ensembl: ENSG00000135097

Protein

• UniProt ID: O43347
• Protein name: RNA-binding protein Musashi homolog 1 (Musashi-1)
• Protein function: RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'-GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	22 → 91	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	111 → 180	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in fetal kidney, brain, liver and lung, and in adult brain and pancreas. Detected in hepatoma cell lines. {ECO:0000269|PubMed:12054577, ECO:0000269|PubMed:9790759}.
• Sequence:

  METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
  RGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNT
  TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE
  CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
  YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
  PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
  YH

• Sequence length: 362

Pathways

KEGG:

mRNA surveillance pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MICROCEPHALY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	19714342, 22012766, 25971681		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18471519		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	26191146		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12558601, 19714342		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	19714342		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	23769888, 28082422, 30097032		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	22012766		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18826648, 21881409, 22201732, 22985791, 24608801		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30367664	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26064941		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Primary Microcephaly	Microcephaly	BEFREE	28572454		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21916995	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28216140		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18826648, 30362859		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18826648, 33120728	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20727204, 22626806, 24022895, 26373800		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22626806, 24022895, 33541259, 34291358, 36996499, 37607966	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	23715514		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18419830, 19258308, 21829201, 21881409, 22012766, 22258704, 24151393	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16955534, 18419830, 19714342		★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26191146	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24305552	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25747387, 31888604	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20477901		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23715514, 24787949, 30065613		★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	20305619	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26499463	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26373800		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26191146		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26563371, 31031868		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25362645, 28088346		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18419830, 25362645, 28088346		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18826648, 21881409, 22201732, 22985791, 24608801		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24787949		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18235245, 21442350, 25394506, 30097032		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21881409	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24525742, 25940441, 28082422, 28526879		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19714342		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28526879, 33882945	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28764761	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18473332, 21165952		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18473332		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18473332, 29398419		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35269992	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28713964		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24163304	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28713964		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24163304, 28713964, 30202417	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	21916995	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	26191146		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21881409	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22201732, 22258704, 26100017, 26821357, 28821879, 29467947, 30322656, 30362859, 30959276, 31004009, 31756732		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22258704, 24075410, 26100017, 27470713, 30362859, 30959276	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22201732, 22258704, 26100017, 28821879, 29467947, 29486283, 30322656, 30362859, 30959276, 31004009, 31756732, 31824472		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12054577, 16163378, 23017339		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24022895	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Types I and II	Hereditary angioedema	Pubtator	25971681	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21881409	Stimulate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30942388		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	26673327		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	21829201, 24151393	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	26327765, 32945509	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	28764761	Inhibit	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28853300		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31217428		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12054577, 24305552, 25747387		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12054577		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	12054577		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	31888604	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20305619, 23715514, 24787949	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22012766, 24151393, 28713964	Associate	★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	31127937		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17238803, 31756732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20727204, 22626806, 24022895, 26373800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28713964		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12054577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23715514, 24787949, 30065613		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26563371, 31031868		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23164718, 24452324, 28521458, 31558975		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20477901		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18471519, 18826648, 21442350, 22201732, 24163304, 24787949, 25362645, 26191146, 27176780, 28143872, 28526879, 28713964, 28862656, 29113163, 29141252, 29486283, 30065613, 30097032, 30250616, 30362859, 30367664, 30441806, 31059073		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25362645, 28088346		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18235245, 21442350, 25394506, 30097032		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20727204		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18826648, 21881409, 22201732, 22985791, 24608801		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	18826648		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18826648, 35011618	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21881409	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12054577		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28704657		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	35269992	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12558601, 18419830, 18471519, 19714342, 20727204, 21165952, 21881409, 22201732, 22258704, 23017339, 23164718, 23769888, 24163304, 24452324, 24525742, 25362645, 26191146, 26373800, 28082422, 28345785, 29110645, 29113163, 30097032, 30202417, 30322656, 30362859, 31004009, 31031868, 31824472		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	21881409		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29794872		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22201732, 31004009, 31532069		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16955534, 29141252		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29113163		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	25971681		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26563371, 31031868		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26563371		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25971681, 26563371, 34768932	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33253517	Associate	★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	LHGDN	16106215		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32882325	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	25940441		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27129280		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30891314		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	25283629	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	24525742		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23715514, 31059073		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24163304, 28713964, 30202417		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	28626726		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23164718, 24452324, 28521458, 31558975		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	21829201	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21829201, 24151393	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22626806		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22626806	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26229399		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24061461	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18419830	Associate	★☆☆☆☆ Found in Text Mining only