Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	440854
Gene name	Calpain 14
Gene symbol	CAPN14
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2p23.1
Summary	Calpains are a family of cytosolic calcium-activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin-cytoskeletal interactions, and synaptic plasticity (Dear et al., 2000 [PubMed 10

Show/Hide all (38)

miRTarBase ID	miRNA	Experiments
MIRT861905	hsa-miR-1224-3p	CLIP-seq
MIRT861906	hsa-miR-1253	CLIP-seq
MIRT861907	hsa-miR-1295	CLIP-seq
MIRT861908	hsa-miR-3121-5p	CLIP-seq
MIRT861909	hsa-miR-3124-3p	CLIP-seq
MIRT861910	hsa-miR-3163	CLIP-seq
MIRT861911	hsa-miR-3194-5p	CLIP-seq
MIRT861912	hsa-miR-3198	CLIP-seq
MIRT861913	hsa-miR-3646	CLIP-seq
MIRT861914	hsa-miR-3673	CLIP-seq
MIRT861915	hsa-miR-3685	CLIP-seq
MIRT861916	hsa-miR-384	CLIP-seq
MIRT861917	hsa-miR-4251	CLIP-seq
MIRT861918	hsa-miR-4309	CLIP-seq
MIRT861919	hsa-miR-4690-3p	CLIP-seq
MIRT861920	hsa-miR-4717-5p	CLIP-seq
MIRT861921	hsa-miR-4760-5p	CLIP-seq
MIRT861922	hsa-miR-496	CLIP-seq
MIRT861923	hsa-miR-579	CLIP-seq
MIRT861924	hsa-miR-590-3p	CLIP-seq
MIRT2193358	hsa-miR-188-5p	CLIP-seq
MIRT2193359	hsa-miR-2355-3p	CLIP-seq
MIRT861908	hsa-miR-3121-5p	CLIP-seq
MIRT2193360	hsa-miR-3616-5p	CLIP-seq
MIRT2193361	hsa-miR-3647-5p	CLIP-seq
MIRT2193362	hsa-miR-3935	CLIP-seq
MIRT2193363	hsa-miR-4301	CLIP-seq
MIRT2193364	hsa-miR-4646-3p	CLIP-seq
MIRT2193365	hsa-miR-4762-3p	CLIP-seq
MIRT2193366	hsa-miR-4766-5p	CLIP-seq
MIRT2193367	hsa-miR-563	CLIP-seq
MIRT2193368	hsa-miR-573	CLIP-seq
MIRT2193369	hsa-miR-676	CLIP-seq
MIRT861912	hsa-miR-3198	CLIP-seq
MIRT861918	hsa-miR-4309	CLIP-seq
MIRT861921	hsa-miR-4760-5p	CLIP-seq
MIRT861922	hsa-miR-496	CLIP-seq
MIRT861924	hsa-miR-590-3p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0004198	Function	Calcium-dependent cysteine-type endopeptidase activity	IBA
GO:0004198	Function	Calcium-dependent cysteine-type endopeptidase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
610229	16664	ENSG00000214711

A8MX76

Protein name

Calpain-14 (EC 3.4.22.-) (Calcium-activated neutral proteinase 14) (CANP 14)

Protein function

Calcium-regulated non-lysosomal thiol-protease.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00648	Peptidase_C2	44 → 334	Calpain family cysteine protease	Family
PF01067	Calpain_III	355 → 491	Calpain large subunit, domain III	Domain

Tissue specificity

TISSUE SPECIFICITY: Not expressed in tissues tested.

Sequence

MSLWPPFRCRWKLAPRYSRRASPQQPQQDFEALLAECLRNGCLFEDTSFPATLSSIGSGS
LLQKLPPRLQWKRPPELHSNPQFYFAKAKRLDLCQGIVGDCWFLAALQALALHQDILSRV
VPLNQSFTEKYAGIFRFWFWHYGNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEK
AYAKLSGSYEDLQSGQVSEALVDFTGGVTMTINLAEAHGNLWDILIEATYNRTLIGCQTH
SGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPWGKVEWKGDWSDSSSKWELLS
PKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQEAAQKWTYTMREGRWEKR
STAGGQRQLLQDTFWKNPQFLLSVWRPEEGRRSLRPCSVLVSLLQKPRHRCRKRKPLLAI
GFYLYRMNKYHDDQRRLPPEFFQRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCILEA
HQKSEFVLRVFSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKFFEKHPEINAVQLQN
LLNQMTWSSLGSRQPFFSLEACQGILALLDLNASGTMSIQEFRDLWKQLKLSQKVFHKQD
RGSGYLNWEQLHAAMREAGIMLSDDVCQLMLIRYGGPRLQMDFVSFIHLMLRVENMEDVF
QNLTQDGKGIYLQKPEWMMMALYS

Sequence length

684

Interactions

View interactions

	Reactome
			Degradation of the extracellular matrix

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Amyotrophic lateral sclerosis	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BREAST DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic sensitization	Allergic Sensitization	BEFREE	25666870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	GWASCAT_DG	28333195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	25017104, 25407941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	CTD_human_DG	25017104		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	25017104, 25407941, 26258919, 29029802, 29129581, 31909633, 33446329, 34815391, 37652141	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	BEFREE	26258919, 26418324, 28131390, 28224995, 28757265, 29029802, 29980278, 30903437		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30626591	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	28757265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	23133572		★★★★★ ★☆☆☆☆ Found in Text Mining only

CAPN14 (calpain 14)